[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : levG
DDBJ      :levG         phosphotransferase system (PTS) fructose-specific enzyme IID component
Swiss-Prot:PTFD_BACSU   RecName: Full=Fructose permease IID component;AltName: Full=PTS system fructose-specific EIID component;AltName: Full=EIID-Fru;AltName: Full=p30;

Homologs  Archaea  1/68 : Bacteria  215/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:275 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->274 PF03613 * EIID-AGA 3e-70 51.1 %
:HMM:PFM   5->274 PF03613 * EIID-AGA 8e-109 54.8 263/264  
:BLT:SWISS 1->275 PTFD_BACSU e-139 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14646.1 GT:GENE levG GT:PRODUCT phosphotransferase system (PTS) fructose-specific enzyme IID component GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2760233..2761060) GB:FROM 2760233 GB:TO 2761060 GB:DIRECTION - GB:GENE levG GB:PRODUCT phosphotransferase system (PTS) fructose-specific enzyme IID component GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15849754, 16850406, 2117666, 9033408; Product type t: transporter GB:PROTEIN_ID CAB14646.1 GB:DB_XREF GOA:P26382 InterPro:IPR018405 SubtiList:BG10319 UniProtKB/Swiss-Prot:P26382 GB:GENE:GENE levG LENGTH 275 SQ:AASEQ MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQRHLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTIRPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQKLTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGLTLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA GT:EXON 1|1-275:0| SW:ID PTFD_BACSU SW:DE RecName: Full=Fructose permease IID component;AltName: Full=PTS system fructose-specific EIID component;AltName: Full=EIID-Fru;AltName: Full=p30; SW:GN Name=levG; OrderedLocusNames=BSU27040; SW:KW Cell membrane; Complete proteome; Membrane; Phosphotransferase system;Sugar transport; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->275|PTFD_BACSU|e-139|100.0|275/275| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|Phosphotransferase system| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 5 TM:REGION 29->51| TM:REGION 126->148| TM:REGION 187->209| TM:REGION 226->248| TM:REGION 253->275| SEG 124->139|laalgaslalggniag| SEG 155->166|kyyglkygyvkg| RP:PFM:NREP 1 RP:PFM:REP 6->274|PF03613|3e-70|51.1|262/263|EIID-AGA| HM:PFM:NREP 1 HM:PFM:REP 5->274|PF03613|8e-109|54.8|263/264|EIID-AGA| GO:PFM:NREP 2 GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03613|IPR004704| GO:PFM GO:0016021|"GO:integral to membrane"|PF03613|IPR004704| OP:NHOMO 573 OP:NHOMOORG 216 OP:PATTERN ----------------1--------------------------------------------------- ------------------------------------------------------------------------------3---------------------------------------------------------------------------------------------------------------1----------1-------1-11-1-------1--444444----------------------D1116E1131522--6714522211132344443334443343444433333333333333331113333---29111-1--312-5---542---1-3--------------111-212----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111-1----------------------------2---------------------1----1--1------------311133-2544254543-4323444443454332334433122213432333443324223322244221-222222212222111---------------2222121----2111----------------------------------------112--------12-----------------1---------------------------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 86-91| PSIPRED ccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc //