[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : lmrB
DDBJ      :lmrB         efflux transporter; drug-export protein
Swiss-Prot:LMRB_BACSU   RecName: Full=Lincomycin resistance protein lmrB;

Homologs  Archaea  37/68 : Bacteria  647/915 : Eukaryota  83/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:479 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   335->422 1v54A PDBj 2e-04 37.5 %
:RPS:SCOP  4->192 1pw4A  f.38.1.1 * 5e-11 11.2 %
:HMM:SCOP  9->479 1pw4A_ f.38.1.1 * 3e-67 25.6 %
:RPS:PFM   22->405 PF07690 * MFS_1 2e-16 26.7 %
:HMM:PFM   22->415 PF07690 * MFS_1 3.6e-48 24.1 344/353  
:BLT:SWISS 1->479 LMRB_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12061.1 GT:GENE lmrB GT:PRODUCT efflux transporter; drug-export protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(288653..290092) GB:FROM 288653 GB:TO 290092 GB:DIRECTION - GB:GENE lmrB GB:PRODUCT efflux transporter; drug-export protein GB:FUNCTION 16.1: Circulate 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15317768, 15849754, 16850406; Product type t: transporter GB:PROTEIN_ID CAB12061.1 GB:DB_XREF GOA:O35018 InterPro:IPR001411 SubtiList:BG12613 UniProtKB/Swiss-Prot:O35018 GB:GENE:GENE lmrB LENGTH 479 SQ:AASEQ MILETTAKASQQYKVMPIMISLLLAGFIGMFSETALNIALTDLMKELNITAATVQWLTTGYLLVLGILVPVSGLLLQWFTTRQLFTVSLIFSILGTFIAALAPSFSFLLAARIVQALGTGLLLPLMFNTILVIFPPHKRGAAMGTIGLVIMFAPAIGPTFSGLVLEHLNWHWIFWISLPFLVLALVFGIAYMQNVSETTKPKIDVLSIILSTIGFGGIVFGFSNAGEGSGGWSSPTVIVSLIVGVVGLILFSIRQLTMKQPMMNLRAFKYPMFILGVIMVFICMMVILSSMLLLPMYLQGGLVLTAFASGLVLLPGGILNGFMSPVTGRLFDKYGPKWLVIPGFVIVTVVLWFFSNVTTTSTAVLIIILHTCLMIGISMIMMPAQTNGLNQLPREFYPDGTAIMNTLQQMAGAIGTAVAVSIMAAGQHDYMSTVKNPADPAVIPQALTAGVQHAFVFAMIVAIIGLIGAFFMKRVKVDH GT:EXON 1|1-479:0| SW:ID LMRB_BACSU SW:DE RecName: Full=Lincomycin resistance protein lmrB; SW:GN Name=lmrB; Synonyms=yccA; OrderedLocusNames=BSU02670; SW:KW Antibiotic resistance; Cell membrane; Complete proteome; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->479|LMRB_BACSU|0.0|100.0|479/479| GO:SWS:NREP 5 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 14 TM:REGION 17->39| TM:REGION 54->76| TM:REGION 86->108| TM:REGION 114->135| TM:REGION 143->165| TM:REGION 172->194| TM:REGION 203->225| TM:REGION 234->256| TM:REGION 271->293| TM:REGION 302->324| TM:REGION 334->356| TM:REGION 363->385| TM:REGION 408->429| TM:REGION 451->472| SEG 99->111|aalapsfsfllaa| SEG 237->253|vivslivgvvglilfsi| BL:PDB:NREP 1 BL:PDB:REP 335->422|1v54A|2e-04|37.5|80/513| RP:PFM:NREP 1 RP:PFM:REP 22->405|PF07690|2e-16|26.7|337/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 22->415|PF07690|3.6e-48|24.1|344/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 4->192|1pw4A|5e-11|11.2|188/434|f.38.1.1| HM:SCP:REP 9->479|1pw4A_|3e-67|25.6|394/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 3403 OP:NHOMOORG 767 OP:PATTERN ------9555555563-4111--2--------2121--1-11-774231-341----11-1454---- 4254i32655655485544-4611B75555549657EMGC4G6E687448528856-5--CE63556OLE3333347512721131112211-2-----1-41--7-1-2--------------111111-1111-3553321152--------------------1--3-------------2321---272A99A9A9AC5BCA99A72875AAA93343552645565AN343333333333333533464783EG35324DC77FC538A7A76433311-1224-----------11111111111111-----1--11--9D111212121135BB1332-----3--2-453331--3321111--11-711211112249774236322311331333334-2353374828--D443AB3CCA2343-1----2122---4444444433313113------------1111111111111------333334234GJKHLICA9A9DDHEBB9B6CMCK7A9D--779-132251428225---1-332222222---112-13-3-2--11--2-2-12113-122224-12----------------------11-77224121--22212222-12433-1111-111-1----------67652745555566655-5555556555565555553AEA685556525554555546454C55365641-544444444444----55343----1-433111-21-22-1----44444141132-44647966255631454121112212-1222333331111132444442221-----------11-------------------------------------1--------111 ----11-------1144954767BHD58754667662222223--2758888FA55567466-12----4--3-5-1111-222-154-831413112133-2246----------------------------------------------------1------------------------------6----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 16.7 SQ:SECSTR ##############################################################################################################################################################################################################################################################################################################################################HHHHHHHHHHHH#####HHHHcccccHHHHHH###HHHHHHHHHHHHTHHHHHHHTTccTTcccGGGHHHHHHHHHHHHHHHHHHHHH######################################################### DISOP:02AL 1-15, 477-479| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //