[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : lytT
DDBJ      :lytT         two-component response regulator [LytS]
Swiss-Prot:LYTT_BACSU   RecName: Full=Sensory transduction protein lytT;

Homologs  Archaea  4/68 : Bacteria  580/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:241 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->115 2qv0A PDBj 7e-19 42.1 %
:BLT:PDB   142->239 3d6wA PDBj 5e-12 39.2 %
:RPS:PDB   1->115 3b2nA PDBj 1e-20 20.9 %
:RPS:PDB   133->239 3d6wA PDBj 6e-28 34.3 %
:RPS:SCOP  3->118 1p2fA2  c.23.1.1 * 8e-19 27.0 %
:HMM:SCOP  1->118 1s8nA_ c.23.1.1 * 6.5e-28 37.4 %
:RPS:PFM   4->114 PF00072 * Response_reg 8e-14 35.8 %
:RPS:PFM   145->239 PF04397 * LytTR 1e-19 45.7 %
:HMM:PFM   144->239 PF04397 * LytTR 2.5e-34 46.9 96/98  
:HMM:PFM   4->113 PF00072 * Response_reg 2e-25 35.2 108/112  
:BLT:SWISS 1->241 LYTT_BACSU e-137 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14852.1 GT:GENE lytT GT:PRODUCT two-component response regulator [LytS] GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2955783..2956508) GB:FROM 2955783 GB:TO 2956508 GB:DIRECTION - GB:GENE lytT GB:PRODUCT two-component response regulator [LytS] GB:FUNCTION 16.3: Control 16.13: Shape GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 10940023, 11717295, 12034833, 12914674; Product type r: regulator GB:PROTEIN_ID CAB14852.1 GB:DB_XREF GOA:P94514 HSSP:1TMY InterPro:IPR001789 SubtiList:BG11953 UniProtKB/Swiss-Prot:P94514 GB:GENE:GENE lytT LENGTH 241 SQ:AASEQ MLRVLIVDDEMLARDELAYLLKRTNDEMEINEAENIESAFDQMMDQKPDLLFLDVDLSGENGFDIAKRLKKMKHPPAIVFATAYDQYALKAFEVDALDYLTKPFDEERIQQTLKKYKKVNRDIVETEQNSHAGQHKLALSVGESIVIVDTKDIIYAGTEDGHVNVKTFDHSYTVSDTLVVIEKKLPDSDFIRVHRSFVVNTEYIKEIQPWFNSTYNLIMKDGSKIPVSRTYAKELKKLLHI GT:EXON 1|1-241:0| SW:ID LYTT_BACSU SW:DE RecName: Full=Sensory transduction protein lytT; SW:GN Name=lytT; OrderedLocusNames=BSU28920; SW:KW Complete proteome; Cytoplasm; DNA-binding; Phosphoprotein;Transcription; Transcription regulation;Two-component regulatory system. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->241|LYTT_BACSU|e-137|100.0|241/241| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|Two-component regulatory system| BL:PDB:NREP 2 BL:PDB:REP 2->115|2qv0A|7e-19|42.1|107/122| BL:PDB:REP 142->239|3d6wA|5e-12|39.2|97/107| RP:PDB:NREP 2 RP:PDB:REP 1->115|3b2nA|1e-20|20.9|115/120| RP:PDB:REP 133->239|3d6wA|6e-28|34.3|105/107| RP:PFM:NREP 2 RP:PFM:REP 4->114|PF00072|8e-14|35.8|109/111|Response_reg| RP:PFM:REP 145->239|PF04397|1e-19|45.7|94/97|LytTR| HM:PFM:NREP 2 HM:PFM:REP 144->239|PF04397|2.5e-34|46.9|96/98|LytTR| HM:PFM:REP 4->113|PF00072|2e-25|35.2|108/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 3->118|1p2fA2|8e-19|27.0|111/120|c.23.1.1| HM:SCP:REP 1->118|1s8nA_|6.5e-28|37.4|115/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 1886 OP:NHOMOORG 589 OP:PATTERN -----------------------1-----------1----------13-------------------- 2A91211--------------2---2------222211111--112211111111--1--111-12222112------22332-112277C6-9-----22L488Y4U6D-------1--11111--------11-233314-11-2--111111------------114----------------11-2-15399A9A8A96AA97995577559C83539621433336DM3222222122222221111241--12----2332222221-11---333434351144433443344232222223222222233322224DA6J666666845578772454D631-58C44BD945444446375-3185-------------------1-------------------------1-----1--1---1-----1------1---------------1-1------------------------------23221-11-12112111122122312335-42123342--22142244311323121211251--------1-114-2632133-26221-485466836212361345---1------------1--13-1---322337435353333333223334241348----1-2------43321333333333333-333333333333323333333322232121112121121111123323332--311111111111---122222111112512------1--------1111111-2-3344442443322223434----------3445444343333357535331221111--4-4411221-------1-1-------------------------11123222122B1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------2-----------1--1-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHHHccEEEEEEEccHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHTTcccEEEEEEccHHHHHHHHHTTccEEEETTccHHHHHHHHHHHHTTccEEcHHHHHHHHcccEEEEEccccEEEEEGGGGEEEEEETTEEEEEEcccEEEEcccHHHHHHHccTTTEEEEETTEEEEGGGEEEEEccccccEEEEETTccEEEEcTTTHHHHHHHHTc DISOP:02AL 120-135| PSIPRED ccEEEEEcccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEcccEEEEEEEcccEEEEEEcccEEEEEHHHHHHHHHHcccccEEEccHHHHHHHHHHHcccccccEEEEEEEcccEEEEEHHHHHHHHHHHcc //