[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : maa
DDBJ      :maa          maltose O-acetyltransferase
Swiss-Prot:MAA_BACSU    RecName: Full=Probable maltose O-acetyltransferase;         EC=2.3.1.79;AltName: Full=Maltose transacetylase;

Homologs  Archaea  24/68 : Bacteria  515/915 : Eukaryota  92/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->184 2ic7A PDBj 2e-73 70.5 %
:RPS:PDB   12->184 3ectA PDBj 6e-33 42.9 %
:RPS:SCOP  3->183 1kqaA  b.81.1.3 * 4e-36 39.2 %
:HMM:SCOP  3->184 1ocxA_ b.81.1.3 * 4.2e-54 41.8 %
:RPS:PFM   6->59 PF12464 * Mac 8e-13 59.3 %
:HMM:PFM   6->59 PF12464 * Mac 7e-21 53.7 54/55  
:HMM:PFM   95->110 PF00132 * Hexapep 3.8e-05 50.0 16/18  
:HMM:PFM   137->153 PF00132 * Hexapep 2e-06 64.7 17/18  
:HMM:PFM   148->163 PF00132 * Hexapep 0.00016 62.5 16/18  
:BLT:SWISS 1->184 MAA_BACSU e-107 100.0 %
:PROS 139->167|PS00101|HEXAPEP_TRANSFERASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16122.1 GT:GENE maa GT:PRODUCT maltose O-acetyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4195778..4196332) GB:FROM 4195778 GB:TO 4196332 GB:DIRECTION - GB:GENE maa GB:PRODUCT maltose O-acetyltransferase GB:FUNCTION 16.8: Protect GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12731863, 12793527; Product type e: enzyme GB:PROTEIN_ID CAB16122.1 GB:DB_XREF GOA:P37515 HSSP:1OCX InterPro:IPR018357 SubtiList:BG10043 UniProtKB/Swiss-Prot:P37515 GB:GENE:GENE maa LENGTH 184 SQ:AASEQ MLRTEKEKMAAGELYNSEDQQLLLERKHARQLIRQYNETPEDDAVRTKLLKELLGSVGDQVTILPTFRCDYGYHIHIGDHTFVNFDCVILDVCEVRIGCHCLIAPGVHIYTAGHPLDPIERKSGKEFGKPVTIGDQVWIGGRAVINPGVTIGDNAVIASGSVVTKDVPANTVVGGNPARILKQL GT:EXON 1|1-184:0| SW:ID MAA_BACSU SW:DE RecName: Full=Probable maltose O-acetyltransferase; EC=2.3.1.79;AltName: Full=Maltose transacetylase; SW:GN Name=maa; Synonyms=yyaI; OrderedLocusNames=BSU40850; SW:KW Complete proteome; Repeat; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->184|MAA_BACSU|e-107|100.0|184/184| GO:SWS:NREP 1 GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 139->167|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| BL:PDB:NREP 1 BL:PDB:REP 2->184|2ic7A|2e-73|70.5|183/185| RP:PDB:NREP 1 RP:PDB:REP 12->184|3ectA|6e-33|42.9|170/173| RP:PFM:NREP 1 RP:PFM:REP 6->59|PF12464|8e-13|59.3|54/55|Mac| HM:PFM:NREP 4 HM:PFM:REP 6->59|PF12464|7e-21|53.7|54/55|Mac| HM:PFM:REP 95->110|PF00132|3.8e-05|50.0|16/18|Hexapep| HM:PFM:REP 137->153|PF00132|2e-06|64.7|17/18|Hexapep| HM:PFM:REP 148->163|PF00132|0.00016|62.5|16/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 3->183|1kqaA|4e-36|39.2|181/200|b.81.1.3| HM:SCP:REP 3->184|1ocxA_|4.2e-54|41.8|182/0|b.81.1.3|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 1361 OP:NHOMOORG 631 OP:PATTERN ------------------------21121-21-1--1211111-21-1--342--1---1-------1 1-2-2111111-1--------2---1-----------123-1-213---1--12--1----1--3---4211222143--2----1--8A74-7-----3-1-11256-3--------------1--1-----21-22212-1-1-1333223--1111-1--21-23341---------------11----213333343314324531222223461221431222223162333333333333331--12326-2315121873311333--14232221---2--211222211121----1---1---4222212223-11373335434344-32211211121--231-212-----1-------4--31---111-1-2-----111112--11-11-111-11111423251-344-23244413--1-211221111-111111111---1-3----------------1---------------11--1-----111-111------12------1242--1--211--1--1--2---------1----------12---1112-2411233222--21-122-11-333-------------2---------1----551113-12112568511543334444254------2------221214-3333333321-333233423333333233111113211232222222222222222211122-----------------3111111111--3-3111222--------21112121----31122331-123321111----------345443343347561-11111----------311--1-----------1------------------1---------11111-1-12 ----41--------1-4435444334422122222222221323332312442447332322212-11111121-11111-1111111----4---3132-21--2---------------------------------------------------------2------------1--51-1--1---3--1-1433- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 100.0 SQ:SECSTR ccGGccccTTcHHHTccccHHHHHHHHHHHHHHHHHHHccHcHHHHHHHHHHHccEEcTTcEEcccEEEcccTTEEEccccEEcTEEEcccEccEEEccccEEcTTcEEEcEEccccGGGGTTcccEEccEEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcccccccEEEETTTTEEEEEc DISOP:02AL 1-4| PSIPRED ccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccEEEcccEEEEEccEEEEcccEEEccccEEEEccEEEEccccEEccccEEEEcccccccccccccccccccEEEccccEEccccEEEccEEEccccEEEccEEEEcccccccEEEEcccEEEEcc //