[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : malL
DDBJ      :malL         oligo-1,4-1,6-alpha-glucosidase (sucrase-maltase-isomaltase)
Swiss-Prot:O16G1_BACSU  RecName: Full=Oligo-1,6-glucosidase 1;         EC=3.2.1.10;AltName: Full=Oligosaccharide alpha-1,6-glucosidase 1;AltName: Full=Sucrase-isomaltase 1;         Short=Isomaltase 1;AltName: Full=Dextrin 6-alpha-D-glucanohydrolase;

Homologs  Archaea  25/68 : Bacteria  607/915 : Eukaryota  143/199 : Viruses  0/175   --->[See Alignment]
b.71.1c.1.8
:561 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->557 1uokA PDBj 0.0 58.1 %
:RPS:PDB   3->556 3czkA PDBj 1e-83 17.8 %
:RPS:SCOP  3->482 1m53A2  c.1.8.1 * e-114 45.5 %
:RPS:SCOP  483->557 1uokA1  b.71.1.1 * 1e-17 41.3 %
:HMM:SCOP  3->480 1m53A2 c.1.8.1 * 2.6e-153 42.3 %
:HMM:SCOP  483->559 1uokA1 b.71.1.1 * 5.7e-21 42.9 %
:RPS:PFM   34->379 PF00128 * Alpha-amylase 1e-57 45.2 %
:RPS:PFM   458->556 PF11941 * DUF3459 5e-04 27.7 %
:HMM:PFM   27->381 PF00128 * Alpha-amylase 7.5e-117 47.8 316/316  
:HMM:PFM   490->539 PF02806 * Alpha-amylase_C 9.1e-05 20.4 49/93  
:BLT:SWISS 1->561 O16G1_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15461.1 GT:GENE malL GT:PRODUCT oligo-1,4-1,6-alpha-glucosidase (sucrase-maltase-isomaltase) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3547550..3549235) GB:FROM 3547550 GB:TO 3549235 GB:DIRECTION - GB:GENE malL GB:PRODUCT oligo-1,4-1,6-alpha-glucosidase (sucrase-maltase-isomaltase) GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10229946, 16707683, 9573215; Product type e: enzyme GB:PROTEIN_ID CAB15461.1 GB:DB_XREF GOA:O06994 HSSP:1UOK InterPro:IPR013781 SubtiList:BG12421 UniProtKB/Swiss-Prot:O06994 GB:GENE:GENE malL LENGTH 561 SQ:AASEQ MSEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIGSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQERADLKSISLKPYEAVMGISI GT:EXON 1|1-561:0| SW:ID O16G1_BACSU SW:DE RecName: Full=Oligo-1,6-glucosidase 1; EC=3.2.1.10;AltName: Full=Oligosaccharide alpha-1,6-glucosidase 1;AltName: Full=Sucrase-isomaltase 1; Short=Isomaltase 1;AltName: Full=Dextrin 6-alpha-D-glucanohydrolase; SW:GN Name=malL; Synonyms=yvdL; OrderedLocusNames=BSU34560; SW:KW Complete proteome; Cytoplasm; Glycosidase; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->561|O16G1_BACSU|0.0|100.0|561/561| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016798|"GO:hydrolase activity, acting on glycosyl bonds"|Glycosidase| GO:SWS GO:0008152|"GO:metabolic process"|Glycosidase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 3->557|1uokA|0.0|58.1|549/558| RP:PDB:NREP 1 RP:PDB:REP 3->556|3czkA|1e-83|17.8|511/618| RP:PFM:NREP 2 RP:PFM:REP 34->379|PF00128|1e-57|45.2|290/296|Alpha-amylase| RP:PFM:REP 458->556|PF11941|5e-04|27.7|94/115|DUF3459| HM:PFM:NREP 2 HM:PFM:REP 27->381|PF00128|7.5e-117|47.8|316/316|Alpha-amylase| HM:PFM:REP 490->539|PF02806|9.1e-05|20.4|49/93|Alpha-amylase_C| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00128|IPR006047| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00128|IPR006047| GO:PFM GO:0043169|"GO:cation binding"|PF00128|IPR006047| RP:SCP:NREP 2 RP:SCP:REP 3->482|1m53A2|e-114|45.5|473/478|c.1.8.1| RP:SCP:REP 483->557|1uokA1|1e-17|41.3|75/79|b.71.1.1| HM:SCP:REP 3->480|1m53A2|2.6e-153|42.3|471/478|c.1.8.1|1/1|(Trans)glycosidases| HM:SCP:REP 483->559|1uokA1|5.7e-21|42.9|77/79|b.71.1.1|1/1|Glycosyl hydrolase domain| OP:NHOMO 2299 OP:NHOMOORG 775 OP:PATTERN --1-1--1222222112-------3--5213-------------------1----2-232-111---- 35127131222---12222-23--332222222444113314224242344157A314--1142513775244333432--13-----2221-4-----5151255167----------------1212211121256566---9248B333111--22222221-43451-1---2-1----7763412-273555555554555555244415555654-368577575-342222222222222211132452-6911525AA2269252442655222443522223333433232422224444222223322-333231-152222222727-422-4445-13--28-111-1--72-133231-2--23331-----1233111-22222------------21511423422-2225542354332142322-333311---------1---1-32------------------------------32-2--1-11111-111111111131-111-111111---1114-1-----15---122-21----------322-1-1--111-------111-221-14414231----------------------------5554-22-3352322223-222-21-2--3---2---------36--1413333333333-33333334333333333334542111-311323333323333242213332--333333333333-------------1-714---242-------------------4B11311212211114111---------1133422222365552233333122------11221111--------1-5----1--11-3-----21--31---467333143423- --11221-------1875459998684111--1---1------1112334697965423444-22-3441--3-5A75IA-2222567-442736343431-1--1--216111131--1--11111117B1-11511-11111111---11111112125638548BBGG2234---3J---1--25131---1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 557 STR:RPRED 99.3 SQ:SECSTR EEHHccTTGGGcTTccEEEEcHHHHHccHHHHHHTHHHHHHHTccEEEEcccEEEcccccTTcEEEEEEEcTTTccHHHHHHHHHHHHHTTcEEEEEccccEEETTcHHHHHHHTTcHHHHTTccEEcccHHHHHHcccccTTTccccEEEETTTTEEEEccccTTEEEccTTcHHHHHHHHHHHHHHHHTTccEEEETTTTcccccTTTccHTTTccccHHHTccccccHHHHHHHHHHHHHHHHHcTcEEEEcccccGGGcGGGGccGTTccccEEEcHHHHHHHHHHHHHHHHHHHHHTcTHHHHHHHHTcccccTTEcEEEEEccccccEEGGGGHHHHTcccHHHHHTTccccccHHHHHHHHHTccTTcccccEEccccEEEccHHHHTTHHHHHHTTcHHHHHHHHHHHHHHccEEEEEETTGGGTccccGGcGGGGGcccccHHHHHTTccTTcHHHHHHHHHHHHHHHTcGGGcTTccEEEccTTEEEEEEEcETTTEEEEEEcccccEEEcGGGTHHTcccEEcccccccccEEcccEEEcTTcEEE#### PSIPRED ccHHHHccEEEEEEccHHccccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHccccccccccEEEccccccccccccccEEEcccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHcccccccccEEEccccccHHHHccccccccccccccHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEEcHHHccccccccHHHHccHHHHcHHHHHHHHcccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHcHHHcccEEEEEEcccccEEEEEEEEccEEEEEEEEcccccEEEEcccccccccEEEEEcccccccccccEEEEccccEEEEEEc //