[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : menH
DDBJ      :menH         menaquinone methyltransferase
Swiss-Prot:UBIE_BACSU   RecName: Full=Menaquinone biosynthesis methyltransferase ubiE;         EC=2.1.1.-;AltName: Full=Spore germination protein C2;

Homologs  Archaea  35/68 : Bacteria  758/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:233 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->158 3dh0B PDBj 2e-14 27.0 %
:RPS:PDB   1->233 3dp7A PDBj 1e-32 12.6 %
:RPS:SCOP  13->222 2gh1A1  c.66.1.49 * 2e-28 16.9 %
:HMM:SCOP  1->233 1xvaA_ c.66.1.5 * 7e-51 27.8 %
:RPS:PFM   1->233 PF01209 * Ubie_methyltran 5e-57 42.9 %
:HMM:PFM   1->233 PF01209 * Ubie_methyltran 2.1e-116 48.5 233/233  
:BLT:SWISS 1->233 UBIE_BACSU e-138 100.0 %
:PROS 20->35|PS01183|UBIE_1
:PROS 141->155|PS01184|UBIE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14191.1 GT:GENE menH GT:PRODUCT menaquinone methyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2382907..2383608) GB:FROM 2382907 GB:TO 2383608 GB:DIRECTION - GB:GENE menH GB:PRODUCT menaquinone methyltransferase GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.10: Respire GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16279806, 9045837, 9139683; Product type e: enzyme GB:PROTEIN_ID CAB14191.1 GB:DB_XREF GOA:P31113 InterPro:IPR004033 SubtiList:BG10280 UniProtKB/Swiss-Prot:P31113 GB:GENE:GENE menH LENGTH 233 SQ:AASEQ MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAGKSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMRRVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEEAGLKNVKYHSFTGGVAATHIGWK GT:EXON 1|1-233:0| SW:ID UBIE_BACSU SW:DE RecName: Full=Menaquinone biosynthesis methyltransferase ubiE; EC=2.1.1.-;AltName: Full=Spore germination protein C2; SW:GN Name=menH; Synonyms=gerC2, gerCB, menG, ubiE;OrderedLocusNames=BSU22750; SW:KW Complete proteome; Menaquinone biosynthesis; Methyltransferase;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->233|UBIE_BACSU|e-138|100.0|233/233| GO:SWS:NREP 3 GO:SWS GO:0009234|"GO:menaquinone biosynthetic process"|Menaquinone biosynthesis| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 20->35|PS01183|UBIE_1|PDOC00911| PROS 141->155|PS01184|UBIE_2|PDOC00911| BL:PDB:NREP 1 BL:PDB:REP 37->158|3dh0B|2e-14|27.0|122/190| RP:PDB:NREP 1 RP:PDB:REP 1->233|3dp7A|1e-32|12.6|214/351| RP:PFM:NREP 1 RP:PFM:REP 1->233|PF01209|5e-57|42.9|233/234|Ubie_methyltran| HM:PFM:NREP 1 HM:PFM:REP 1->233|PF01209|2.1e-116|48.5|233/233|Ubie_methyltran| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 13->222|2gh1A1|2e-28|16.9|195/281|c.66.1.49| HM:SCP:REP 1->233|1xvaA_|7e-51|27.8|227/292|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1360 OP:NHOMOORG 976 OP:PATTERN ------11------11--------123221221------12--2213512854-1113131-111--- 1452111111111122111-121121111112422231221122112122212221111121111121111--------1111112111111-111-111111112111111111111111111111112211131111324442133153322111111111321132221-112221111221211---21222222222122221212111222112111111111111111111111111111111111--1----11-11111-----11--11----------------------------------------------2-31111111-1---11---------3--1311321---23----11-211211111111122111111111111111111111-1111111122212111122222221112113111111111111111111122111111111111111111111111111111111212111111122212122222112222222211111111122111111122231112211111111111113112114311211131111113111111111111313111111111111111111111111112111111111111111111111111111111--13212------22111211111111111-11111111111111111112221211121111211111121112111111111211111111111111111111111131211111-1-1----111111111112111211211121122121111111111111111111111111111111111111111111121112211-----------------------------------------1-222111 11-124--311-11121221231242211111112111111111-1222211121121111111211111113111111111111212-56311121111112114--2121211111-11111111-12B1-11211-1111111111-11-1121111--11111111112112224c4452331122423322112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 100.0 SQ:SECSTR ccccHHHHGGGccHHHHHHHHHHHHHTTccHGGcccHHHHHHHGGGcccEEEEEccTTcHHHHHHHHHcTTcEEHHEEEEcHHHHHHHHHHHTTcTTGGEEEEcccccccccccccccEEEEEcccTTccHHHHHHHHHHHHccTTcEEEEEEccTTccccHHHHHHHHHHcEEcccccTTccEHHHHHHccccccccccHHHHHHHHHTTTEEEcccccccTTTcEEEEEEE DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHccccEEEEEEEccEEEEEEEEcc //