[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : mobA
DDBJ      :mobA         molybdopterin-guanine dinucleotide biosynthesis protein A
Swiss-Prot:MOBA_BACSU   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A;

Homologs  Archaea  20/68 : Bacteria  147/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->187 1h4dA PDBj 5e-10 29.7 %
:RPS:PDB   1->183 2e8bA PDBj 2e-19 23.7 %
:RPS:SCOP  1->190 1e5kA  c.68.1.8 * 4e-14 24.2 %
:HMM:SCOP  1->190 1e5kA_ c.68.1.8 * 1.3e-20 23.9 %
:BLT:SWISS 1->199 MOBA_BACSU e-114 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13299.1 GT:GENE mobA GT:PRODUCT molybdopterin-guanine dinucleotide biosynthesis protein A GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1495505..1496104 GB:FROM 1495505 GB:TO 1496104 GB:DIRECTION + GB:GENE mobA GB:PRODUCT molybdopterin-guanine dinucleotide biosynthesis protein A GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2b: Function of strongly homologous gene; PubMedId: 10978347; Product type e: enzyme GB:PROTEIN_ID CAB13299.1 GB:DB_XREF GOA:O31701 SubtiList:BG12621 UniProtKB/Swiss-Prot:O31701 GB:GENE:GENE mobA LENGTH 199 SQ:AASEQ MKHVNVLLAGGASRRFGEPKAFVKWKGRMLYECAKEALGEQTVIISRPEFIDRFQENGENEVYQDAEPFQGMGPLAGIYTAFKKTDGDLYTVLSCDTPLIQRRTMLELKRLMIAGADAVVPISDGQVQPLIAIYHKRIMPVLYDQLSEKRLRISDLLGRISVCYVQAENIGANPAEFININTRDDFSCLEEKSNSLKRD GT:EXON 1|1-199:0| SW:ID MOBA_BACSU SW:DE RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A; SW:GN Name=mobA; OrderedLocusNames=BSU14260; SW:KW Complete proteome; Cytoplasm; GTP-binding;Molybdenum cofactor biosynthesis; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->199|MOBA_BACSU|e-114|100.0|199/199| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|Molybdenum cofactor biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| BL:PDB:NREP 1 BL:PDB:REP 6->187|1h4dA|5e-10|29.7|172/188| RP:PDB:NREP 1 RP:PDB:REP 1->183|2e8bA|2e-19|23.7|173/185| RP:SCP:NREP 1 RP:SCP:REP 1->190|1e5kA|4e-14|24.2|182/188|c.68.1.8| HM:SCP:REP 1->190|1e5kA_|1.3e-20|23.9|184/0|c.68.1.8|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 174 OP:NHOMOORG 167 OP:PATTERN ----------------1--1---1--------1-1-1-1111-11--11-----1-1112----1--- -1-----------------------------------------------------------------------------11----111-------------1--------------------------------1------111------------------------------------------11-----1111111111111111-111111111111--1------1-11111111111111111111----------------------------------------------------------------------111-1----------11----1-----1----111--1--111--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11------1----223111311------11------------------------1---1--1-----------1-1------------------------111-------1-1111-----11-1111-11------111-----1111111111111111-------1---------------------------------------------------------------1----1-1------------------1111-111--1----------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 96.0 SQ:SECSTR cccEEEEEEEcccccccTTHHHHHHHHHHHHHHHHHHHccEEEEEEcccGGGGGGGGcTcTccEEEcccccccHHHHHHHHHHHccccEEEEEETTcTTccHHHHHHHHHTccccEEEEEcEETccEEEEEEEEEGGGHHHHHHHHHTTcccHHHHHHHHccEEEEccGGGGGGGGGccccccHHHHHHHH######## DISOP:02AL 196-199| PSIPRED ccEEEEEEEccccccccccccEEEEccEEHHHHHHHHHcccEEEEEcccHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHccccEEEEEcccccccEEEEEcHHHHHHHHHHHHcccccHHHHHHHcccEEEEEccccccHHHHcccccHHHHHHHHHHHHccccc //