[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : motA
DDBJ      :motA         motility protein A; MotA component of the stator flagellum complex
Swiss-Prot:MOTA_BACSU   RecName: Full=Chemotaxis protein motA;AltName: Full=Motility protein A;

Homologs  Archaea  0/68 : Bacteria  434/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:270 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   109->211 PF01618 * MotA_ExbB 8e-13 38.2 %
:HMM:PFM   92->223 PF01618 * MotA_ExbB 2.6e-32 33.6 131/139  
:HMM:PFM   3->95 PF03706 * UPF0104 0.001 13.5 89/294  
:BLT:SWISS 1->270 MOTA_BACSU e-131 100.0 %
:PROS 186->203|PS01307|MOTA
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13242.1 GT:GENE motA GT:PRODUCT motility protein A; MotA component of the stator flagellum complex GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1434433..1435245) GB:FROM 1434433 GB:TO 1435245 GB:DIRECTION - GB:GENE motA GB:PRODUCT motility protein A; MotA component of the stator flagellum complex GB:FUNCTION 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16095621; Product type f: factor GB:PROTEIN_ID CAB13242.1 GB:DB_XREF GOA:P28611 InterPro:IPR002898 SubtiList:BG10688 UniProtKB/Swiss-Prot:P28611 GB:GENE:GENE motA LENGTH 270 SQ:AASEQ MDKTSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVPTLFRVLFKENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVDDAFLKNGLSMAVDGQSAEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAVIGLIAALSHMDNTDELGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVMIEGVLSVLEGQAPKVIEQKLLMYLPAKDRLKFAEQGEAQNGEKKEEEA GT:EXON 1|1-270:0| SW:ID MOTA_BACSU SW:DE RecName: Full=Chemotaxis protein motA;AltName: Full=Motility protein A; SW:GN Name=motA; OrderedLocusNames=BSU13690; SW:KW Cell membrane; Chemotaxis; Complete proteome; Flagellar rotation;Hydrogen ion transport; Ion transport; Membrane; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->270|MOTA_BACSU|e-131|100.0|270/270| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006935|"GO:chemotaxis"|Chemotaxis| GO:SWS GO:0001539|"GO:ciliary or flagellar motility"|Flagellar rotation| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 186->203|PS01307|MOTA|PDOC01011| TM:NTM 4 TM:REGION 4->26| TM:REGION 35->56| TM:REGION 146->168| TM:REGION 178->200| SEG 29->41|alanpaailiiia| SEG 86->99|aqlarregllalea| RP:PFM:NREP 1 RP:PFM:REP 109->211|PF01618|8e-13|38.2|102/132|MotA_ExbB| HM:PFM:NREP 2 HM:PFM:REP 92->223|PF01618|2.6e-32|33.6|131/139|MotA_ExbB| HM:PFM:REP 3->95|PF03706|0.001|13.5|89/294|UPF0104| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF01618|IPR002898| GO:PFM GO:0008565|"GO:protein transporter activity"|PF01618|IPR002898| GO:PFM GO:0016020|"GO:membrane"|PF01618|IPR002898| OP:NHOMO 538 OP:NHOMOORG 434 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------1---1---1--1-1--------1-1------------------11-11--------------------1------------------------------------1---------------------------------------------112222122222222222112212222111121111111121------------------------------------------------------------------------------------------12123222222222212111---111--11111211211111311111---11----1----1-1111111111111111111111-1111111-----1---111111111-------1111-1--------------122--------------------------------1-1111121112112111122211111112221111--111---------1-11121111--------1-1111313-1123-35443111111111111-1----1121-111111111111111111----33-1422112-1111111111111211111---1222------11--1-11111111111-1111111111111111111---111-11-111111111111111--1111111111111111111---------1111--313-------------------------2111111111211112111---------2111111111111111111111111------112222221111111111--------------------------1-11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 252-270| PSIPRED cHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHcccHHHHHHHHHHHcccccc //