[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : mrpE
DDBJ      :mrpE         non essential component of Na+/H+ antiporter
Swiss-Prot:MRPE_BACSU   RecName: Full=Na(+)/H(+) antiporter subunit E;AltName: Full=Multiple resistance and pH homeostasis protein E;AltName: Full=Mrp complex subunit E;

Homologs  Archaea  9/68 : Bacteria  147/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   58->146 PF01899 * MNHE 9e-19 49.4 %
:HMM:PFM   54->156 PF01899 * MNHE 5.7e-24 42.6 101/106  
:HMM:PFM   3->45 PF03899 * ATP_synt_I 7.4e-05 25.6 43/100  
:BLT:SWISS 1->158 MRPE_BACSU 2e-79 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAE01465.2 GT:GENE mrpE GT:PRODUCT non essential component of Na+/H+ antiporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3251248..3251724 GB:FROM 3251248 GB:TO 3251724 GB:DIRECTION + GB:GENE mrpE GB:PRODUCT non essential component of Na+/H+ antiporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15849754, 16233411, 16850406, 11004162, 10198001; Product type t : transporter GB:PROTEIN_ID CAE01465.2 GB:DB_XREF GOA:Q7WY60 InterPro:IPR002758 SubtiList:BG14181 UniProtKB/Swiss-Prot:Q7WY60 GB:GENE:GENE mrpE LENGTH 158 SQ:AASEQ MAFQILLNVFLAFCWMFLSNSPSAAGFITGYILGMLSLFFFRRFFTRQFYLWKLISIIKLCFIFIKELYLANVSVMKSVLSPKLNIRPGIFAFKTELTKDWEITMLSLLITLTPGTLVMDISDDRTILYIHAMDIEDAEKAIFDIRESFEKAIQEVSR GT:EXON 1|1-158:0| SW:ID MRPE_BACSU SW:DE RecName: Full=Na(+)/H(+) antiporter subunit E;AltName: Full=Multiple resistance and pH homeostasis protein E;AltName: Full=Mrp complex subunit E; SW:GN Name=mrpE; OrderedLocusNames=BSU31640; SW:KW Antiport; Cell membrane; Complete proteome; Hydrogen ion transport;Ion transport; Membrane; Sodium; Sodium transport; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->158|MRPE_BACSU|2e-79|100.0|158/158| GO:SWS:NREP 8 GO:SWS GO:0015297|"GO:antiporter activity"|Antiport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006814|"GO:sodium ion transport"|Sodium transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 1->23| TM:REGION 55->77| TM:REGION 101->123| SEG 39->49|fffrrfftrqf| RP:PFM:NREP 1 RP:PFM:REP 58->146|PF01899|9e-19|49.4|89/106|MNHE| HM:PFM:NREP 2 HM:PFM:REP 54->156|PF01899|5.7e-24|42.6|101/106|MNHE| HM:PFM:REP 3->45|PF03899|7.4e-05|25.6|43/100|ATP_synt_I| GO:PFM:NREP 3 GO:PFM GO:0006812|"GO:cation transport"|PF01899|IPR002758| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF01899|IPR002758| GO:PFM GO:0016021|"GO:integral to membrane"|PF01899|IPR002758| OP:NHOMO 182 OP:NHOMOORG 156 OP:PATTERN ----1------------------------1-----------------1-1-----11-121------- -------------------------------------------------------------------------------------------------------1----1----------------1--1-11---111111----1----------------------------------------------11---------------211111---1-12211111111--12222222222222222222----------------------------------------------------------------------------------------------1---1----11------------1-------------------1-------1111111111----------1---1111-1111111-----11-1111-----------------1------------------------------------------------------------------1---------111---------11-----------------1-----1-------------1--1----11---------------------------------2--1-11-----------------------111---------------------------------------------------------------------------------------------11111------111---------------111111------1111----1----2------------1----11111-----111-1--111--------------------------------------------------12-111-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 158-159| PSIPRED cHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcc //