[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : mrpF
DDBJ      :mrpF         efflux transporter for Na+ and cholate
Swiss-Prot:MRPF_BACSU   RecName: Full=Na(+)/H(+) antiporter subunit F;AltName: Full=Multiple resistance and pH homeostasis protein F;AltName: Full=Mrp complex subunit F;AltName: Full=Sodium-cholate efflux protein mrpF;

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:HMM:PFM   31->84 PF04066 * MrpF_PhaF 4.3e-26 57.4 54/55  
:BLT:SWISS 1->94 MRPF_BACSU 2e-35 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15153.2 GT:GENE mrpF GT:PRODUCT efflux transporter for Na+ and cholate GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3251724..3252008 GB:FROM 3251724 GB:TO 3252008 GB:DIRECTION + GB:GENE mrpF GB:PRODUCT efflux transporter for Na+ and cholate GB:FUNCTION 16.1: Circulate 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10198001, 11004162, 11356194, 12682299, 15019740; Product type t : transporter GB:PROTEIN_ID CAB15153.2 GB:DB_XREF GOA:O05228 InterPro:IPR007208 SubtiList:BG12344 UniProtKB/Swiss-Prot:O05228 GB:GENE:GENE mrpF LENGTH 94 SQ:AASEQ MFTLILQIALGIMAVSTFLYVIRVIKGPTVPDRVVALDAIGINLIAITALVSILLKTSAFLDIILLLGILSFIGTIAFSKFLEKGEIIENDRNR GT:EXON 1|1-94:0| SW:ID MRPF_BACSU SW:DE RecName: Full=Na(+)/H(+) antiporter subunit F;AltName: Full=Multiple resistance and pH homeostasis protein F;AltName: Full=Mrp complex subunit F;AltName: Full=Sodium-cholate efflux protein mrpF; SW:GN Name=mrpF; Synonyms=yufC; OrderedLocusNames=BSU31650; SW:KW Antiport; Cell membrane; Complete proteome; Hydrogen ion transport;Ion transport; Membrane; Sodium; Sodium transport; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->94|MRPF_BACSU|2e-35|100.0|94/94| GO:SWS:NREP 8 GO:SWS GO:0015297|"GO:antiporter activity"|Antiport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006814|"GO:sodium ion transport"|Sodium transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 4->26| TM:REGION 34->56| TM:REGION 61->83| SEG 60->76|fldiilllgilsfigti| HM:PFM:NREP 1 HM:PFM:REP 31->84|PF04066|4.3e-26|57.4|54/55|MrpF_PhaF| OP:NHOMO 41 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------1-1111---1-1-21-111111--11111111111111111111-------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //