[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : mrpG
DDBJ      :mrpG         non essential component of Na+/H+ antiporter
Swiss-Prot:MRPG_BACSU   RecName: Full=Na(+)/H(+) antiporter subunit G;AltName: Full=Multiple resistance and pH homeostasis protein G;AltName: Full=Mrp complex subunit G;

Homologs  Archaea  12/68 : Bacteria  120/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->93 PF03334 * PhaG_MnhG_YufB 3e-14 51.2 %
:HMM:PFM   12->94 PF03334 * PhaG_MnhG_YufB 2.4e-29 50.6 81/81  
:BLT:SWISS 1->124 MRPG_BACSU 5e-67 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15154.1 GT:GENE mrpG GT:PRODUCT non essential component of Na+/H+ antiporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3251992..3252366 GB:FROM 3251992 GB:TO 3252366 GB:DIRECTION + GB:GENE mrpG GB:PRODUCT non essential component of Na+/H+ antiporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11004162, 11356194, 15019740, 15849754, 16850406; Product type t : transporter GB:PROTEIN_ID CAB15154.1 GB:DB_XREF GOA:O05227 InterPro:IPR005133 SubtiList:BG12343 UniProtKB/Swiss-Prot:O05227 GB:GENE:GENE mrpG LENGTH 124 SQ:AASEQ MIETAKVVVAVFILLGALICLIASFGVLRLPDVFTRAHAASKGSTLGVNMILLGVFFYLWFVTGELSAKILLGILFIFITSPIGGHLICRAAYNSGVKLDERSVQDDYNGIRNFVIKRKEDSYL GT:EXON 1|1-124:0| SW:ID MRPG_BACSU SW:DE RecName: Full=Na(+)/H(+) antiporter subunit G;AltName: Full=Multiple resistance and pH homeostasis protein G;AltName: Full=Mrp complex subunit G; SW:GN Name=mrpG; Synonyms=yufB; OrderedLocusNames=BSU31660; SW:KW Antiport; Cell membrane; Complete proteome; Hydrogen ion transport;Ion transport; Membrane; Sodium; Sodium transport; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->124|MRPG_BACSU|5e-67|100.0|124/124| GO:SWS:NREP 8 GO:SWS GO:0015297|"GO:antiporter activity"|Antiport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006814|"GO:sodium ion transport"|Sodium transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 7->29| TM:REGION 39->61| TM:REGION 67->89| RP:PFM:NREP 1 RP:PFM:REP 12->93|PF03334|3e-14|51.2|80/81|PhaG_MnhG_YufB| HM:PFM:NREP 1 HM:PFM:REP 12->94|PF03334|2.4e-29|50.6|81/81|PhaG_MnhG_YufB| GO:PFM:NREP 3 GO:PFM GO:0005451|"GO:monovalent cation:hydrogen antiporter activity"|PF03334|IPR005133| GO:PFM GO:0015672|"GO:monovalent inorganic cation transport"|PF03334|IPR005133| GO:PFM GO:0015992|"GO:proton transport"|PF03334|IPR005133| OP:NHOMO 155 OP:NHOMOORG 132 OP:PATTERN ----------------------------1111------------------1---1211132------- ----------------------------------------------------1------------1--1-------------1--------------------1------------------------1--1---1111----------------------------------------------1------11---------------211111---1-12211111111--1222122222222221--1-------------------------------------------------------------------------------------------------------111------------1--------1--------------1111----------------------1--111-1111111---1-22-----1----------------1------------------------------------------------------------------1---------------------1------------------------1-------------1-11-----1------------------------------------1--1-----------------1-----1-1---------------------------------------------------------------------------------------------11111-----1-11---------------1111111-----1111----1----2------------1----------------1-1--111--------------------------------------------------11-111-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 118-124| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccc //