[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : mtrB
DDBJ      :mtrB         tryptophan operon RNA-binding attenuation protein (TRAP)
Swiss-Prot:MTRB_BACSU   RecName: Full=Transcription attenuation protein mtrB;AltName: Full=Tryptophan RNA-binding attenuator protein;AltName: Full=Trp RNA-binding attenuation protein;         Short=TRAP;

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.5
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->75 1wapA PDBj 3e-35 100.0 %
:RPS:PDB   6->75 1c9sG PDBj 7e-30 81.4 %
:RPS:SCOP  7->75 1c9sA  b.82.5.1 * 6e-21 82.6 %
:HMM:SCOP  7->75 1c9sA_ b.82.5.1 * 2e-35 85.5 %
:RPS:PFM   6->74 PF02081 * TrpBP 1e-22 78.3 %
:HMM:PFM   1->75 PF02081 * TrpBP 3.6e-48 80.0 75/75  
:BLT:SWISS 1->75 MTRB_BACSU 5e-39 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14193.1 GT:GENE mtrB GT:PRODUCT tryptophan operon RNA-binding attenuation protein (TRAP) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2384534..2384761) GB:FROM 2384534 GB:TO 2384761 GB:DIRECTION - GB:GENE mtrB GB:PRODUCT tryptophan operon RNA-binding attenuation protein (TRAP) GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15099736, 15588817, 16285852, 16306262, 17114058; Product type r: regulator GB:PROTEIN_ID CAB14193.1 GB:DB_XREF GOA:P19466 InterPro:IPR000824 PDB:1WAP SubtiList:BG10278 UniProtKB/Swiss-Prot:P19466 GB:GENE:GENE mtrB LENGTH 75 SQ:AASEQ MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMKSEKK GT:EXON 1|1-75:0| SW:ID MTRB_BACSU SW:DE RecName: Full=Transcription attenuation protein mtrB;AltName: Full=Tryptophan RNA-binding attenuator protein;AltName: Full=Trp RNA-binding attenuation protein; Short=TRAP; SW:GN Name=mtrB; OrderedLocusNames=BSU22770; SW:KW 3D-structure; Complete proteome; RNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|MTRB_BACSU|5e-39|100.0|75/75| GO:SWS:NREP 3 GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 8->75|1wapA|3e-35|100.0|68/68| RP:PDB:NREP 1 RP:PDB:REP 6->75|1c9sG|7e-30|81.4|70/70| RP:PFM:NREP 1 RP:PFM:REP 6->74|PF02081|1e-22|78.3|69/72|TrpBP| HM:PFM:NREP 1 HM:PFM:REP 1->75|PF02081|3.6e-48|80.0|75/75|TrpBP| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF02081|IPR000824| GO:PFM GO:0006353|"GO:transcription termination"|PF02081|IPR000824| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02081|IPR000824| RP:SCP:NREP 1 RP:SCP:REP 7->75|1c9sA|6e-21|82.6|69/71|b.82.5.1| HM:SCP:REP 7->75|1c9sA_|2e-35|85.5|69/69|b.82.5.1|1/1|TRAP-like| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111111---11111--------11------------------------------------------------------------------------------------------1--------------1---------1-----11--11111-11---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 70 STR:RPRED 93.3 SQ:SECSTR #####cccEEEEEEccTTEEEEEEEccccccEEEEEEEcTTcEEEEEccccEEEEEEEccEEEEETTEEEEEccc DISOP:02AL 1-5, 68-75| PSIPRED ccccccccEEEEEEEcccEEEEEEEccccccEEcccccccccEEEEEEccccEEEEEEEEEEEEEEccEEEEccc //