[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : nadA
DDBJ      :nadA         quinolinate synthetase
Swiss-Prot:NADA_BACSU   RecName: Full=Quinolinate synthetase A;         EC=2.5.1.72;

Homologs  Archaea  50/68 : Bacteria  632/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.145.1d.241.1
:368 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->339 2qs0A PDBj 1e-26 39.5 %
:RPS:PDB   6->94 2arhC PDBj 3e-17 13.5 %
:RPS:SCOP  25->115 1wzuA1  c.145.1.1 * 6e-06 37.9 %
:RPS:SCOP  160->247 1neeA1  d.241.1.1 * 2e-11 22.2 %
:HMM:SCOP  26->367 1wzuA1 c.145.1.1 * 6e-98 43.6 %
:RPS:PFM   43->365 PF02445 * NadA 1e-59 48.6 %
:HMM:PFM   28->367 PF02445 * NadA 4e-110 47.1 295/296  
:BLT:SWISS 1->368 NADA_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14745.1 GT:GENE nadA GT:PRODUCT quinolinate synthetase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2845955..2847061) GB:FROM 2845955 GB:TO 2847061 GB:DIRECTION - GB:GENE nadA GB:PRODUCT quinolinate synthetase GB:FUNCTION 16.10: Respire GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15898769, 15937336, 15967443, 18959769; Product type e: enzyme GB:PROTEIN_ID CAB14745.1 GB:DB_XREF GOA:Q9KWZ1 InterPro:IPR003473 SubtiList:BG12629 UniProtKB/Swiss-Prot:Q9KWZ1 GB:GENE:GENE nadA LENGTH 368 SQ:AASEQ MSILDVIKQSNDMMPESYKELSRKDMETRVAAIKKKFGSRLFIPGHHYQKDEVIQFADQTGDSLQLAQVAEKNKEADYIVFCGVHFMAETADMLTSEQQTVVLPDMRAGCSMADMADMQQTNRAWKKLQHIFGDTIIPLTYVNSTAEIKAFVGKHGGATVTSSNAKKVLEWAFTQKKRILFLPDQHLGRNTAYDLGIALEDMAVWDPMKDELVAESGHTNVKVILWKGHCSVHEKFTTKNIHDMRERDPDIQIIVHPECSHEVVTLSDDNGSTKYIIDTINQAPAGSKWAIGTEMNLVQRIIHEHPDKQIESLNPDMCPCLTMNRIDLPHLLWSLEQIEKGEPSGVIKVPKAIQEDALLALNRMLSIT GT:EXON 1|1-368:0| SW:ID NADA_BACSU SW:DE RecName: Full=Quinolinate synthetase A; EC=2.5.1.72; SW:GN Name=nadA; OrderedLocusNames=BSU27850; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Iron; Iron-sulfur;Metal-binding; Pyridine nucleotide biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->368|NADA_BACSU|0.0|100.0|368/368| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0019363|"GO:pyridine nucleotide biosynthetic process"|Pyridine nucleotide biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 43->339|2qs0A|1e-26|39.5|248/294| RP:PDB:NREP 1 RP:PDB:REP 6->94|2arhC|3e-17|13.5|89/188| RP:PFM:NREP 1 RP:PFM:REP 43->365|PF02445|1e-59|48.6|280/296|NadA| HM:PFM:NREP 1 HM:PFM:REP 28->367|PF02445|4e-110|47.1|295/296|NadA| GO:PFM:NREP 2 GO:PFM GO:0008987|"GO:quinolinate synthetase A activity"|PF02445|IPR003473| GO:PFM GO:0009435|"GO:NAD biosynthetic process"|PF02445|IPR003473| RP:SCP:NREP 2 RP:SCP:REP 25->115|1wzuA1|6e-06|37.9|87/271|c.145.1.1| RP:SCP:REP 160->247|1neeA1|2e-11|22.2|63/98|d.241.1.1| HM:SCP:REP 26->367|1wzuA1|6e-98|43.6|298/0|c.145.1.1|1/1|NadA-like| OP:NHOMO 693 OP:NHOMOORG 683 OP:PATTERN ---1-1-11--11111-11---1-111111-111111111111111121221111111111-----11 11111-111111-111111-11111111111111111111111111111--1111111--111-1111111----111----11111111111111---1-1---1-111---------------111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111-1111111-11---------------1--------------------------------------------------------------------------11-111111111-1111111111--1---1111111111111----1-1-1111111-----1111111111111----------1-11111111121-111111111111-1111--1-----1111111111111-11111111111111-------------------111111----111111111111111111111111111111111111111111111111111111111111111111111-111111211111111111121111111211--1-------11111111111111111111111111112111111111111111111--1111------1111-111111111111-11111111111111111111111111-11111111111111111111111-11111111111111--1111111111111111---------------11111111111111111111111111111111111111111111111111111----------1111111-111111---------------------------------------111-111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 332 STR:RPRED 90.2 SQ:SECSTR #####HHTTccEEEEEcTTcHHHHHHHTTccGGGcHHHHHHHTTTccEEEEEEccTTTTTcEEEEEEccccHHHHHHHHHHHHHTTccccTHHHcTTccEEEccccc####ccTTccHHHHHHHHHHcTTcE#####cEEEccccHHHHTTcc##ccEEEcTTTHHHHHHHccccEcEEEEEccHHHHHHHHHHHccEEE######Ecccc#####HHHccEEE###ccccTGGGccHHHHHHHHTccccccEEEcTTccHHHHTTccccccHHHHHHHHHHHcTTcccEEEccHHHHHHHGGGcccEEccETTTcccccTTcccccHHHHHHHHHHTcc#####cccccHHHHHHHHHHHHHHHHc# DISOP:02AL 368-369| PSIPRED ccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccHHHHHHHHHccccccEEEEEcccHHHHHHHHHcccccEEEEccccccccHHHcccHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHcccccEEEEcHHHHHHHHHccccccEEEEEccHHHHHHHHHHHcccHHHHHccccccccccccccccccEEEEcccccHHHccccHHHHHHHHHHccccEEEEcccccHHHHHHccccccHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHccccEEEEcccccccccHHHcccHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHHHcc //