[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ndk
DDBJ      :ndk          nucleoside diphosphate kinase
Swiss-Prot:NDK_BACSU    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  66/68 : Bacteria  798/915 : Eukaryota  195/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->149 2vu5A PDBj 1e-62 72.3 %
:RPS:PDB   3->149 2cwkB PDBj 2e-58 54.8 %
:RPS:SCOP  2->149 1b4sA  d.58.6.1 * 9e-55 55.1 %
:HMM:SCOP  1->150 2dyaA1 d.58.6.1 * 3.1e-62 53.3 %
:RPS:PFM   3->132 PF00334 * NDK 2e-45 60.0 %
:HMM:PFM   3->136 PF00334 * NDK 9.8e-63 62.7 134/135  
:BLT:SWISS 1->149 NDK_BACSU 3e-84 100.0 %
:PROS 113->121|PS00469|NDP_KINASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14189.1 GT:GENE ndk GT:PRODUCT nucleoside diphosphate kinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2381354..2381803) GB:FROM 2381354 GB:TO 2381803 GB:DIRECTION - GB:GENE ndk GB:PRODUCT nucleoside diphosphate kinase GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 11734624, 9179491; Product type e: enzyme GB:PROTEIN_ID CAB14189.1 GB:DB_XREF GOA:P31103 HSSP:1NPK InterPro:IPR001564 SubtiList:BG10282 UniProtKB/Swiss-Prot:P31103 GB:GENE:GENE ndk LENGTH 149 SQ:AASEQ MMEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMAEKHYAEHQGKPFFGELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGDYGMFVGKNIIHGSDSLESAEREINIFFKNEELVSYQQLMAGWIY GT:EXON 1|1-149:0| SW:ID NDK_BACSU SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=BSU22730; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|NDK_BACSU|3e-84|100.0|149/149| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 113->121|PS00469|NDP_KINASES|PDOC00409| BL:PDB:NREP 1 BL:PDB:REP 2->149|2vu5A|1e-62|72.3|148/148| RP:PDB:NREP 1 RP:PDB:REP 3->149|2cwkB|2e-58|54.8|146/152| RP:PFM:NREP 1 RP:PFM:REP 3->132|PF00334|2e-45|60.0|130/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 3->136|PF00334|9.8e-63|62.7|134/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 2->149|1b4sA|9e-55|55.1|147/150|d.58.6.1| HM:SCP:REP 1->150|2dyaA1|3.1e-62|53.3|150/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1670 OP:NHOMOORG 1060 OP:PATTERN 11-1111111111111-111111111111111111111111111111111111111111111111111 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111--------------111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111------11 2122434-61223341111111111111111111111111111111-11111111111121111111111111111111111111111-111111122211136431364B89A9BA5395492BF6F7ffF-F8G4557E35EC47853725E4957799645582223312742443O22232A5881593333332 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 149 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGccTTcHHHHHccccccccEEEcccHHHHHHHHHHHccGGGccccccTTTGGGG DISOP:02AL 148-150| PSIPRED ccEEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEEEccHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccEEccccccccccEEcccccHHHHHHHHHHHccHHHEEEcccccccccc //