[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ntdC
DDBJ      :ntdC         biosynthesis of neotrehalosadiamine (3,3'-diamino-3,3'-dideoxy-alpha,beta-trehalose), dehydrogenase
Swiss-Prot:NTDC_BACSU   RecName: Full=NTD biosynthesis operon putative oxidoreductase ntdC;         EC=1.-.-.-;

Homologs  Archaea  26/68 : Bacteria  372/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:350 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   18->203 3e18B PDBj 5e-15 30.9 %
:RPS:PDB   19->336 3ec7A PDBj 7e-35 17.9 %
:RPS:SCOP  19->143 1zh8A1  c.2.1.3 * 2e-24 23.2 %
:RPS:SCOP  129->282 2nvwA2  d.81.1.5 * 1e-16 19.3 %
:HMM:SCOP  2->188 1ydwA1 c.2.1.3 * 3.4e-42 43.4 %
:HMM:SCOP  125->300 2nvwA2 d.81.1.5 * 2e-16 26.7 %
:RPS:PFM   19->112 PF01408 * GFO_IDH_MocA 4e-15 39.4 %
:HMM:PFM   3->118 PF01408 * GFO_IDH_MocA 1e-30 36.2 116/120  
:HMM:PFM   130->250 PF02894 * GFO_IDH_MocA_C 1.6e-23 29.6 115/115  
:BLT:SWISS 1->350 NTDC_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12893.2 GT:GENE ntdC GT:PRODUCT biosynthesis of neotrehalosadiamine (3,3'-diamino-3,3'-dideoxy-alpha,beta-trehalose), dehydrogenase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1126400..1127452) GB:FROM 1126400 GB:TO 1127452 GB:DIRECTION - GB:GENE ntdC GB:PRODUCT biosynthesis of neotrehalosadiamine (3,3'-diamino-3,3'-dideoxy-alpha,beta-trehalose), dehydrogenase GB:FUNCTION 16.3: Control 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 14612444, 17056753; Product type e: enzyme GB:PROTEIN_ID CAB12893.2 GB:DB_XREF GOA:O07564 InterPro:IPR004104 SubtiList:BG13076 UniProtKB/Swiss-Prot:O07564 GB:GENE:GENE ntdC LENGTH 350 SQ:AASEQ MKKIGIIGAGGIARAHATALSTIKNAELVGVYDINQQNAESFVKTFGGKSFENVDELIDASEGLIVASPNFCHKEHALQALGKHKHVLCEKPMAISLEEASIMKDTAERLSVRASMGFNYRYLSYVNILKSLIINNELGNILSIKVHFKKNSALRRKKFTWRDDANSKKTSGSLGDLGIHLIDMVWYLFESDFITESVRAKMNTNVKTKEDKQVLVDDYAEIYGQLKNKVFVNIITSKCSVPEDCGFSIEVVGHKKEFKYHTGNPHVYKLIDGLNVVDCPVPQSLLNDPPNEFYGWADSFRSELINWIASTQNDWVEIPSFSDGFRSQEVLEMFFEKDSNSQPMSVSAVN GT:EXON 1|1-350:0| SW:ID NTDC_BACSU SW:DE RecName: Full=NTD biosynthesis operon putative oxidoreductase ntdC; EC=1.-.-.-; SW:GN Name=ntdC; Synonyms=yhjJ; OrderedLocusNames=BSU10530; SW:KW Antibiotic biosynthesis; Complete proteome; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->350|NTDC_BACSU|0.0|100.0|350/350| GO:SWS:NREP 3 GO:SWS GO:0017000|"GO:antibiotic biosynthetic process"|Antibiotic biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 4->17|igiigaggiaraha| BL:PDB:NREP 1 BL:PDB:REP 18->203|3e18B|5e-15|30.9|175/337| RP:PDB:NREP 1 RP:PDB:REP 19->336|3ec7A|7e-35|17.9|285/328| RP:PFM:NREP 1 RP:PFM:REP 19->112|PF01408|4e-15|39.4|94/119|GFO_IDH_MocA| HM:PFM:NREP 2 HM:PFM:REP 3->118|PF01408|1e-30|36.2|116/120|GFO_IDH_MocA| HM:PFM:REP 130->250|PF02894|1.6e-23|29.6|115/115|GFO_IDH_MocA_C| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01408|IPR000683| RP:SCP:NREP 2 RP:SCP:REP 19->143|1zh8A1|2e-24|23.2|125/181|c.2.1.3| RP:SCP:REP 129->282|2nvwA2|1e-16|19.3|150/178|d.81.1.5| HM:SCP:REP 2->188|1ydwA1|3.4e-42|43.4|159/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 125->300|2nvwA2|2e-16|26.7|172/0|d.81.1.5|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 741 OP:NHOMOORG 422 OP:PATTERN -----1--2222221-14------1--2--2-1-1---1---1------1-11-2323--31------ 312-1---111---1-1----2----------1324-1321---114--221635--1-----2211311------------1-----1111-1-------112341916---------------111-1-11121---23---2--11-11---11------11----2211221--12221-1---11131222222111-21211163443312115317314444423D322222222222212-----------------------1-----------1111--21122112121-------------1---------33--3222222212--111-----211--12--22--1-----53532--1-3---1-----2-121-1-1-11121221222222-----1---32--533244555632---21231111242---------111--1----------------------------------2---1--------1-------22--------1---------2-----------11---1-------------------------1----111------11--1-----1-------1-1----------------12-1--1-2---------------1--1-------------1--312-2111211211-112111212-12212222-1122322-12--11112-1121--4----1-1--311111111111------------1--1-6111111-----1223----------1------1-1-------------------1---11111--1---1--------------11111111----------1-------------111----------121--1-1---- -----1-------2------1-1----11-----11--------------1-----------------------------------21--1--1---------111---12---------------------------------------------------------------11------------------2211- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 333 STR:RPRED 95.1 SQ:SECSTR #################HHHHTcTTEEEEEEEcccTTHHHHHHHHHTcEEEccHHHHHHcTTEEEEcccGGGHHHHHHHHHHTTcEEEEEccccccHHHHHHHHHHHHHHTccEEEEEcGGGcHHHHHHHHHHHHTTTccEEEEEEEEcccccTTcGGccTTcccTcccTTHHHHTTHHHHHHHHHHHTcccEcEEEEEEEcccccTTcccGGGTTccccEEEEEETTccEEEEEEEETTcccccEEEEEEEEccEEEEEETTccccEEcccccccEEEETTEEEEcccccGGGTcHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHTccEEcTTTG PSIPRED cEEEEEEcccHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHcccEEccHHHHHccccEEEEEcccHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccccccccccEEEEHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccccEEEEEEEEccccEEEEEEEEEEccccccEEEEEEEccEEEEEEcccccEEEEEccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccEEEccccc //