[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : nudF
DDBJ      :nudF         ADP-ribose pyrophosphatase
Swiss-Prot:ADPP_BACSU   RecName: Full=ADP-ribose pyrophosphatase;         EC=3.6.1.13;AltName: Full=ADP-ribose diphosphatase;AltName: Full=Adenosine diphosphoribose pyrophosphatase;         Short=ADPR-PPase;AltName: Full=ADP-ribose phosphohydrolase;         Short=ASPPase;

Homologs  Archaea  36/68 : Bacteria  642/915 : Eukaryota  95/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->129 1mqwA PDBj 2e-22 43.1 %
:RPS:PDB   5->178 3bm4A PDBj 3e-32 29.9 %
:RPS:SCOP  11->176 1v8iA  d.113.1.1 * 1e-36 40.0 %
:HMM:SCOP  5->182 1viuA_ d.113.1.1 * 6.8e-50 45.2 %
:RPS:PFM   45->158 PF00293 * NUDIX 6e-12 38.9 %
:HMM:PFM   44->165 PF00293 * NUDIX 3.3e-24 36.4 121/135  
:BLT:SWISS 1->185 ADPP_BACSU e-100 100.0 %
:PROS 12->25|PS00287|CYSTATIN
:PROS 77->98|PS00893|NUDIX_BOX

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14293.1 GT:GENE nudF GT:PRODUCT ADP-ribose pyrophosphatase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2458509..2459066) GB:FROM 2458509 GB:TO 2459066 GB:DIRECTION - GB:GENE nudF GB:PRODUCT ADP-ribose pyrophosphatase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.3: Control 16.6: Maintain GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 10542272, 17693564; Product type e: enzyme GB:PROTEIN_ID CAB14293.1 GB:DB_XREF GOA:P54570 InterPro:IPR020084 SubtiList:BG11762 UniProtKB/Swiss-Prot:P54570 GB:GENE:GENE nudF LENGTH 185 SQ:AASEQ MKSLEEKTIAKEQIFSGKVIDLYVEDVELPNGKASKREIVKHPGAVAVLAVTDEGKIIMVKQFRKPLERTIVEIPAGKLEKGEEPEYTALRELEEETGYTAKKLTKITAFYTSPGFADEIVHVFLAEELSVLEEKRELDEDEFVEVMEVTLEDALKLVESREVYDAKTAYAIQYLQLKEALQAQK GT:EXON 1|1-185:0| SW:ID ADPP_BACSU SW:DE RecName: Full=ADP-ribose pyrophosphatase; EC=3.6.1.13;AltName: Full=ADP-ribose diphosphatase;AltName: Full=Adenosine diphosphoribose pyrophosphatase; Short=ADPR-PPase;AltName: Full=ADP-ribose phosphohydrolase; Short=ASPPase; SW:GN Name=nudF; Synonyms=yqkG; OrderedLocusNames=BSU23610; SW:KW Complete proteome; Hydrolase; Magnesium; Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->185|ADPP_BACSU|e-100|100.0|185/185| GO:SWS:NREP 2 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 12->25|PS00287|CYSTATIN|PDOC00259| PROS 77->98|PS00893|NUDIX_BOX|PDOC00695| BL:PDB:NREP 1 BL:PDB:REP 7->129|1mqwA|2e-22|43.1|123/200| RP:PDB:NREP 1 RP:PDB:REP 5->178|3bm4A|3e-32|29.9|174/197| RP:PFM:NREP 1 RP:PFM:REP 45->158|PF00293|6e-12|38.9|113/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 44->165|PF00293|3.3e-24|36.4|121/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 11->176|1v8iA|1e-36|40.0|145/150|d.113.1.1| HM:SCP:REP 5->182|1viuA_|6.8e-50|45.2|177/189|d.113.1.1|1/1|Nudix| OP:NHOMO 954 OP:NHOMOORG 773 OP:PATTERN 111-1111111111111-12111-21131122-----------11111----------------1--1 12212111111-1-11111-11--121111112222111112-2211-13311111111121112111131-2221221-111-----1111---------1--121212--------------111----111-1---11111-1122112111111111111211222211111111111121211111111111111111111111121111111111111111111111111111111111111111111112222111122112211111111111111111111111111111111111111111111111111111111212222112121111122211-1111111111111111111112111111111------111-----11--1----------1-11-11-1--1--1221111121-11--1--------1-----------111-11-------------------------------11--11111112212211111221222221211211111111111----1111-112111111-111111--11111111-----------111-1111-------21-----------------------------33-2113112222121222211212122---2111------1232-221111111111-1111111111111111112434221-1212222222222222211111111---1111-111111---111-111111-12-21111111-1111111----------122222112111111-111----------222322222232222211111-112222111-111111--------11--------------------------1112111111-11 -----1----1----111111111112111111111-111111111-1111121-11-1111111-1111111111111111111111--1111---1--2------11112--14---------1------------------------------1-------1-------1---1117---------2---1-12-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 97.8 SQ:SECSTR ##EEccEEEEEEEEEEcccEEEEEEEEEcTTccEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEGGGTEEEEEccEEEccTTccHHHHHHHHHHHHHccccEEEEEcccEEccTTTcccEEEEEEEEcGGGccccccccTTcccEEEEEEGGGHHHHHHHHHHHccEEEcHHHHHHHHHHHHH## DISOP:02AL 1-3, 183-185| PSIPRED cccccEEEEEEEEEEEccEEEEEEEEEEcccccEEEEEEEEcccEEEEEEEccccEEEEEEEEEccccccEEEEccccccccccHHHHHHHHHHHHcccEEEEEEEEEEEEccccccccEEEEEEEEEccccccccccccccEEEEEEEcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccc //