[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ogt
DDBJ      :ogt          O6-alkylguanine DNA alkyltransferase
Swiss-Prot:OGT_BACSU    RecName: Full=Methylated-DNA--protein-cysteine methyltransferase;         EC=2.1.1.63;AltName: Full=6-O-methylguanine-DNA methyltransferase;         Short=MGMT;AltName: Full=O-6-methylguanine-DNA-alkyltransferase;

Homologs  Archaea  28/68 : Bacteria  741/915 : Eukaryota  65/199 : Viruses  1/175   --->[See Alignment]
a.4.2c.55.7
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->143 1sfeA PDBj 2e-19 37.9 %
:RPS:PDB   3->165 1eh6A PDBj 4e-42 29.5 %
:RPS:SCOP  3->82 1eh6A2  c.55.7.1 * 7e-16 23.0 %
:RPS:SCOP  78->165 1eh6A1  a.4.2.1 * 7e-32 37.9 %
:HMM:SCOP  1->83 1qntA2 c.55.7.1 * 1.1e-16 36.1 %
:HMM:SCOP  77->162 1sfeA1 a.4.2.1 * 5e-30 52.4 %
:RPS:PFM   3->73 PF02870 * Methyltransf_1N 2e-11 46.5 %
:RPS:PFM   79->160 PF01035 * DNA_binding_1 3e-21 53.1 %
:HMM:PFM   78->161 PF01035 * DNA_binding_1 1.3e-31 49.4 83/85  
:HMM:PFM   1->75 PF02870 * Methyltransf_1N 6.1e-28 41.3 75/77  
:BLT:SWISS 1->165 OGT_BACSU 6e-94 100.0 %
:PROS 128->134|PS00374|MGMT

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13227.1 GT:GENE ogt GT:PRODUCT O6-alkylguanine DNA alkyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1421426..1421923 GB:FROM 1421426 GB:TO 1421923 GB:DIRECTION + GB:GENE ogt GB:PRODUCT O6-alkylguanine DNA alkyltransferase GB:FUNCTION 16.6: Maintain GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 2308822, 2359121; Product type e: enzyme GB:PROTEIN_ID CAB13227.1 GB:DB_XREF GOA:P11742 HSSP:1SFE InterPro:IPR011991 SubtiList:BG10848 UniProtKB/Swiss-Prot:P11742 GB:GENE:GENE ogt LENGTH 165 SQ:AASEQ MNYYTTAETPLGELIIAEEEDRITRLFLSQEDWVDWKETVQNTEHKETPNLAEAKQQLQEYFAGERKTFSLPLSQKGTPFQQKVWQALERIPYGESRSYADIAAAVGSPKAVRAVGQANKRNDLPIFVPCHRVIGKNSALTGYAGSKTEIKAFLLNIERISYKEK GT:EXON 1|1-165:0| SW:ID OGT_BACSU SW:DE RecName: Full=Methylated-DNA--protein-cysteine methyltransferase; EC=2.1.1.63;AltName: Full=6-O-methylguanine-DNA methyltransferase; Short=MGMT;AltName: Full=O-6-methylguanine-DNA-alkyltransferase; SW:GN Name=ogt; Synonyms=dat, dat1; OrderedLocusNames=BSU13540; SW:KW Complete proteome; DNA damage; DNA repair; Methyltransferase;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->165|OGT_BACSU|6e-94|100.0|165/165| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 128->134|PS00374|MGMT|PDOC00320| BL:PDB:NREP 1 BL:PDB:REP 4->143|1sfeA|2e-19|37.9|140/165| RP:PDB:NREP 1 RP:PDB:REP 3->165|1eh6A|4e-42|29.5|156/168| RP:PFM:NREP 2 RP:PFM:REP 3->73|PF02870|2e-11|46.5|71/75|Methyltransf_1N| RP:PFM:REP 79->160|PF01035|3e-21|53.1|81/85|DNA_binding_1| HM:PFM:NREP 2 HM:PFM:REP 78->161|PF01035|1.3e-31|49.4|83/85|DNA_binding_1| HM:PFM:REP 1->75|PF02870|6.1e-28|41.3|75/77|Methyltransf_1N| GO:PFM:NREP 4 GO:PFM GO:0003908|"GO:methylated-DNA-[protein]-cysteine S-methyltransferase activity"|PF02870|IPR008332| GO:PFM GO:0006281|"GO:DNA repair"|PF02870|IPR008332| GO:PFM GO:0003824|"GO:catalytic activity"|PF01035|IPR014048| GO:PFM GO:0006281|"GO:DNA repair"|PF01035|IPR014048| RP:SCP:NREP 2 RP:SCP:REP 3->82|1eh6A2|7e-16|23.0|74/78|c.55.7.1| RP:SCP:REP 78->165|1eh6A1|7e-32|37.9|87/90|a.4.2.1| HM:SCP:REP 1->83|1qntA2|1.1e-16|36.1|83/0|c.55.7.1|1/1|Methylated DNA-protein cysteine methyltransferase domain| HM:SCP:REP 77->162|1sfeA1|5e-30|52.4|84/0|a.4.2.1|1/1|Methylated DNA-protein cysteine methyltransferase, C-terminal domain| OP:NHOMO 1234 OP:NHOMOORG 835 OP:PATTERN ------1-111111111------1--------11-11------11111-1111-----111------1 113121-11111-111111-121112111111212112331211221212212----1111111--332321111111-1221-----111111111--112111312-3--------------111111-1-1--111111112-2--111----1---------1111----------------1111111222222222122222222222222211131323233323211111111111111111111111-111121111111111111-1-1111111111111111111111-------------1111--11111121111111121111211-11-21111---1133211111111111-111114442-1111212331113323133333323333-111111-1131-322333233233111-112321221231111111122211112------------1-11112---12-----11141133323333333222323333212222733333411334121121122212221112311111111121111111-11-11-1--2111111111112122111211111111111111111112--1111321111211111221221121111111111---21-1------22211312222222212-222222222222222222232334112222222222222222212222222--222222212222--1112111222111212111111111111111222121211112333223332222111111111111111111211111-111122111111111111--11111111--------111-------1----------1-1----1111-11111122 ----11-------1---1-----------------------------111--1-----------1-1--1-11-111111111111-------1----------------1-1--1----111112-1-241-111-1-12-1-1-11--1----1-121---31--1--51251----------1------1-1---- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 165 STR:RPRED 100.0 SQ:SECSTR ccEEEEEccTTccEEEEEETTEEEEEEEcccEEcccccccccccccccHHHHHHHHHHHHHHHcGGGGGccHHHHcccHHHHHHHHHHHHccTTccEEHHHHHHHTTcTTcHHHHHHHTTcccccTTccGGGEEcTTccccccTTccHHHHHHHHHHTTcccccc DISOP:02AL 163-165| PSIPRED ccEEEEEcccccEEEEEEccccEEEEEEccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccEEEcccccHHHHHHHHHHHccccccEEcHHHHHHHHcccccHHHHHHHHHHcccccccccEEEEcccccccccccccHHHHHHHHHHcccccccc //