[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : oxaAA
DDBJ      :oxaAA        Sec-independent factor for membrane protein insertion (YidC/SpoIIIJ family)
Swiss-Prot:OXAA1_BACSU  RecName: Full=Membrane protein oxaA 1;AltName: Full=Stage III sporulation protein J;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  827/915 : Eukaryota  112/199 : Viruses  0/175   --->[See Alignment]
a.59.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   85->163 1e91A PDBj 8e-17 13.0 %
:RPS:SCOP  85->163 1e91A  a.59.1.1 * 3e-17 13.0 %
:RPS:PFM   82->242 PF02096 * 60KD_IMP 3e-34 51.6 %
:HMM:PFM   60->244 PF02096 * 60KD_IMP 3e-73 50.3 181/196  
:BLT:SWISS 1->261 OXAA1_BACSU e-138 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16141.1 GT:GENE oxaAA GT:PRODUCT Sec-independent factor for membrane protein insertion (YidC/SpoIIIJ family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4213823..4214608) GB:FROM 4213823 GB:TO 4214608 GB:DIRECTION - GB:GENE oxaAA GB:PRODUCT Sec-independent factor for membrane protein insertion (YidC/SpoIIIJ family) GB:FUNCTION 16.13: Shape GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11889108, 12586834, 15654078, 15671040, 15849754, 15995216, 16850406; Product type f: factor GB:PROTEIN_ID CAB16141.1 GB:DB_XREF GOA:Q01625 InterPro:IPR013308 SubtiList:BG10062 UniProtKB/Swiss-Prot:Q01625 GB:GENE:GENE oxaAA LENGTH 261 SQ:AASEQ MLLKRRIGLLLSMVGVFMLLAGCSSVKEPITADSPHFWDKYVVYPLSELITYVAKLTGDNYGLSIILVTILIRLLILPLMIKQLRSSKAMQALQPEMQKLKEKYSSKDQKTQQKLQQETMALFQKHGVNPLAGCFPILIQMPILIGFYHAIMRTQAISEHSFLWFDLGEKDPYYILPIVAGVATFVQQKLMMAGNAQQNPQMAMMLWIMPIMIIVFAINFPAALSLYWVVGNLFMIAQTFLIKGPDIKKNPEPQKAGGKKK GT:EXON 1|1-261:0| SW:ID OXAA1_BACSU SW:DE RecName: Full=Membrane protein oxaA 1;AltName: Full=Stage III sporulation protein J;Flags: Precursor; SW:GN Name=oxaA1; Synonyms=spoIIIJ; OrderedLocusNames=BSU41040; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal; Sporulation; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->261|OXAA1_BACSU|e-138|100.0|261/261| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 7->29| TM:REGION 62->84| TM:REGION 129->151| TM:REGION 168->190| TM:REGION 201->223| TM:REGION 226->247| SEG 63->81|lsiilvtilirllilplmi| RP:PDB:NREP 1 RP:PDB:REP 85->163|1e91A|8e-17|13.0|77/85| RP:PFM:NREP 1 RP:PFM:REP 82->242|PF02096|3e-34|51.6|157/191|60KD_IMP| HM:PFM:NREP 1 HM:PFM:REP 60->244|PF02096|3e-73|50.3|181/196|60KD_IMP| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF02096|IPR001708| GO:PFM GO:0051205|"GO:protein insertion into membrane"|PF02096|IPR001708| RP:SCP:NREP 1 RP:SCP:REP 85->163|1e91A|3e-17|13.0|77/85|a.59.1.1| OP:NHOMO 1133 OP:NHOMOORG 939 OP:PATTERN -------------------------------------------------------------------- 111--11122211111112-1111111111111111121111111111111-1121111111111121111-1112111111211111111111111--1111111111-11111111111111111111111111111111-1111-------------------1--1-------------111111111222222222222222222222222222223111222222121111111111111112222212222222222222222222222222222122222222222222222111111111111122222222221211111111111111122111111--11111111111-11111111111111111111111111111111111111111111111-111111111111111111111111111-11111111111--------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------------------------1-1--11111111 ----2-1-------1-----1---1-1-11111--1-111111-----------11--------11----111---1--111111122-1-1----11111-1111--4121111121-1111111-1-391-2--11----------111112---111112-111211---112222S333323217-5223-1113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 29.5 SQ:SECSTR ####################################################################################cccHHHHHHHHHHHHHHHHT##cccHHHHHHHHHHHHHHHHTTccccccccccccHHHHHHHHHHHTcccHHHHHHHHc################################################################################################## DISOP:02AL 1-4, 104-116, 187-204, 248-261| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcHHHHccccccc //