[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : panB
DDBJ      :panB         ketopantoate hydroxymethyltransferase
Swiss-Prot:PANB_BACSU   RecName: Full=3-methyl-2-oxobutanoate hydroxymethyltransferase;         EC=2.1.2.11;AltName: Full=Ketopantoate hydroxymethyltransferase;         Short=KPHMT;

Homologs  Archaea  38/68 : Bacteria  697/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
c.1.12
:277 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->263 1m3uA PDBj 1e-59 44.7 %
:RPS:PDB   7->252 3e5bA PDBj 1e-33 15.7 %
:RPS:SCOP  3->264 1m3uA  c.1.12.8 * 3e-47 46.9 %
:HMM:SCOP  1->262 1o66A_ c.1.12.8 * 7.6e-106 59.6 %
:RPS:PFM   6->259 PF02548 * Pantoate_transf 3e-83 63.0 %
:HMM:PFM   3->259 PF02548 * Pantoate_transf 8.5e-114 57.6 257/261  
:BLT:SWISS 1->277 PANB_BACSU e-157 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14159.1 GT:GENE panB GT:PRODUCT ketopantoate hydroxymethyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2353839..2354672) GB:FROM 2353839 GB:TO 2354672 GB:DIRECTION - GB:GENE panB GB:PRODUCT ketopantoate hydroxymethyltransferase GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 8096212; Product type e: enzyme GB:PROTEIN_ID CAB14159.1 GB:DB_XREF GOA:P52996 HSSP:1OY0 InterPro:IPR015813 SubtiList:BG11519 UniProtKB/Swiss-Prot:P52996 GB:GENE:GENE panB LENGTH 277 SQ:AASEQ MKTKLDFLKMKESEEPIVMLTAYDYPAAKLAEQAGVDMILVGDSLGMVVLGLDSTVGVTVADMIHHTKAVKRGAPNTFIVTDMPFMSYHLSKEDTLKNAAAIVQESGADALKLEGGEGVFESIRALTLGGIPVVSHLGLTPQSVGVLGGYKVQGKDEQSAKKLIEDSIKCEEAGAMMLVLECVPAELTAKIAETLSIPVIGIGAGVKADGQVLVYHDIIGHGVERTPKFVKQYTRIDETIETAISGYVQDVRHRAFPEQKHSFQMNQTVLDGLYGGK GT:EXON 1|1-277:0| SW:ID PANB_BACSU SW:DE RecName: Full=3-methyl-2-oxobutanoate hydroxymethyltransferase; EC=2.1.2.11;AltName: Full=Ketopantoate hydroxymethyltransferase; Short=KPHMT; SW:GN Name=panB; OrderedLocusNames=BSU22430; SW:KW Complete proteome; Cytoplasm; Magnesium; Metal-binding;Methyltransferase; Pantothenate biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->277|PANB_BACSU|e-157|100.0|277/277| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0015940|"GO:pantothenate biosynthetic process"|Pantothenate biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 9->263|1m3uA|1e-59|44.7|253/262| RP:PDB:NREP 1 RP:PDB:REP 7->252|3e5bA|1e-33|15.7|230/397| RP:PFM:NREP 1 RP:PFM:REP 6->259|PF02548|3e-83|63.0|254/261|Pantoate_transf| HM:PFM:NREP 1 HM:PFM:REP 3->259|PF02548|8.5e-114|57.6|257/261|Pantoate_transf| GO:PFM:NREP 2 GO:PFM GO:0003864|"GO:3-methyl-2-oxobutanoate hydroxymethyltransferase activity"|PF02548|IPR003700| GO:PFM GO:0015940|"GO:pantothenate biosynthetic process"|PF02548|IPR003700| RP:SCP:NREP 1 RP:SCP:REP 3->264|1m3uA|3e-47|46.9|260/262|c.1.12.8| HM:SCP:REP 1->262|1o66A_|7.6e-106|59.6|260/0|c.1.12.8|1/1|Phosphoenolpyruvate/pyruvate domain| OP:NHOMO 936 OP:NHOMOORG 857 OP:PATTERN 1111111111111111-111111-1111-111----------------------1111111-----11 11-1111111111111111-111111111111111111111111111-111111111111111-1111111---------11-1111111111111---11121111111---------------111111111111111111111111111111111111111111111111111111111111111---111111111111111111111111111111111111111111-11111111111111111111---------------------------------------------------------------------11-111111111-1111111-----1----111111211--1111-11---11111111111113-11111111111111111111-11111211131-211122222222111111-1111111111111111111-111111---------------------------111112-111121222211111111111111121111111111122111111111111111111111111111111111111111111111-111111111111111111111111111-11111111111111111111111111112222111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---111111111111211---------------1111111111212222221111211111111111111111211111111111111111111111111111-111111------------------------------------11-1111111111 ----111-----22111111111212111111111111111111111111111111111111111111-1111111111111111111-12112111111111111-111---------------------------------------------------------------1-1111I1111111-41331121622 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 99.6 SQ:SECSTR #HHHHHHHHHHHHcccEEEEccccHHHHHHHHHTTcccEEEcHHccTTcccccccccccTTHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccEEEEcTTccccHHHHHHHHHHHHHTccEEEEEcccccccTTcccccEEccHHHHHHHHHHHHHHHHHHTcccEEEEEEcTTTccEEccccTGGGccTTccccTTccEEccccHHHHHHHHGGGccEEEEccccccHHHHHHHHHHHHHHcTTccEHHHHHHHHHHHHHHccc PSIPRED cccHHHHHHHHHcccEEEEEEEccHHHHHHHHHccccEEEEccHHHHHHccccccHHccHHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHccccEEEEccccHHHccccccEEEccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHEEEccHHHHHHHHccc //