[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : panC
DDBJ      :panC         pantothenate synthetase
Swiss-Prot:PANC_BACSU   RecName: Full=Pantothenate synthetase;         Short=PS;         EC=6.3.2.1;AltName: Full=Pantoate--beta-alanine ligase;AltName: Full=Pantoate-activating enzyme;

Homologs  Archaea  0/68 : Bacteria  701/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:286 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->278 2ejcA PDBj 8e-76 51.1 %
:RPS:PDB   1->280 2a88A PDBj 8e-74 38.3 %
:RPS:SCOP  1->280 1ihoA  c.26.1.4 * 3e-48 40.7 %
:HMM:SCOP  1->280 1ihoA_ c.26.1.4 * 2.5e-102 48.9 %
:RPS:PFM   4->278 PF02569 * Pantoate_ligase 4e-75 55.6 %
:HMM:PFM   1->278 PF02569 * Pantoate_ligase 3.7e-130 56.8 278/280  
:BLT:SWISS 1->286 PANC_BACSU e-162 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14158.1 GT:GENE panC GT:PRODUCT pantothenate synthetase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2352977..2353837) GB:FROM 2352977 GB:TO 2353837 GB:DIRECTION - GB:GENE panC GB:PRODUCT pantothenate synthetase GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 17175524, 7037743; Product type e: enzyme GB:PROTEIN_ID CAB14158.1 GB:DB_XREF GOA:P52998 HSSP:1IHO InterPro:IPR014729 SubtiList:BG11520 UniProtKB/Swiss-Prot:P52998 GB:GENE:GENE panC LENGTH 286 SQ:AASEQ MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDYVELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI GT:EXON 1|1-286:0| SW:ID PANC_BACSU SW:DE RecName: Full=Pantothenate synthetase; Short=PS; EC=6.3.2.1;AltName: Full=Pantoate--beta-alanine ligase;AltName: Full=Pantoate-activating enzyme; SW:GN Name=panC; OrderedLocusNames=BSU22420; SW:KW ATP-binding; Complete proteome; Cytoplasm; Ligase; Nucleotide-binding;Pantothenate biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->286|PANC_BACSU|e-162|100.0|286/286| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0015940|"GO:pantothenate biosynthetic process"|Pantothenate biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 1->278|2ejcA|8e-76|51.1|278/280| RP:PDB:NREP 1 RP:PDB:REP 1->280|2a88A|8e-74|38.3|264/276| RP:PFM:NREP 1 RP:PFM:REP 4->278|PF02569|4e-75|55.6|275/279|Pantoate_ligase| HM:PFM:NREP 1 HM:PFM:REP 1->278|PF02569|3.7e-130|56.8|278/280|Pantoate_ligase| GO:PFM:NREP 2 GO:PFM GO:0004592|"GO:pantoate-beta-alanine ligase activity"|PF02569|IPR003721| GO:PFM GO:0015940|"GO:pantothenate biosynthetic process"|PF02569|IPR003721| RP:SCP:NREP 1 RP:SCP:REP 1->280|1ihoA|3e-48|40.7|280/282|c.26.1.4| HM:SCP:REP 1->280|1ihoA_|2.5e-102|48.9|280/282|c.26.1.4|1/1|Nucleotidylyl transferase| OP:NHOMO 852 OP:NHOMOORG 823 OP:PATTERN -------------------------------------------------------------------- 11-1111111111111111-111111111111111111111411111-111111111111111-1121111---------1-11111111111111---11111111111---------------111111111111111111111111111111111111111111111111111111111111111---111111111111111111111111111111111111111111-11111111111111111111---------------------------------------------------------------------1--111111111-1111111-----11---111111211--1111-11---11111111111114111111111111111111111-11111111111-111111111111111111-11111111111111111111111111---------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111-11111111111111111111111111111111111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---111111111111111---------------11111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------11-1111111121 ----111-----11111111111111111111111111111111111111111111111111111111111111111-1111111111-1111111111112-111-111------------------------------------------------------------8----113141121111221121121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 280 STR:RPRED 97.9 SQ:SECSTR cEEEccHHHHHHHHHHHHHTTccEEEEEEcccccHHHHHHHHHHHTcTTcEEEEEccccccTTcccHHHHHHHcHHHHHHHHHHTTccEEEcccHHHHcTTcccccccccGGGGcGGGTTcTTHHHHHHHHHHHHHHHHcccEEEEETTcHHHHHHHHHHHHHTTcccEEEEEcccccTTcccccGGGGGccHHHHHHTHHHHHHHHHHHHHGGGccccHHHHHHHHHHHHHHcTTEEEEEEEEETTcccccccccEEEEEEEEEEETTEEEEEEEEEEE###### DISOP:02AL 285-286| PSIPRED ccEEccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEEcHHcccccccHHHccccHHHHHHHHHHccccEEEccccHHHcccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHccccEEEEEcEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccEEEEEEEEEccEEEEEcEEEcHHHHHcc //