[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : pgsC
DDBJ      :pgsC         capsular polyglutamate amide ligase/translocase subunit
Swiss-Prot:CAPC_BACSU   RecName: Full=PGA biosynthesis protein capC;

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->149 CAPC_BACSU 6e-69 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15606.1 GT:GENE pgsC GT:PRODUCT capsular polyglutamate amide ligase/translocase subunit GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3698982..3699431) GB:FROM 3698982 GB:TO 3699431 GB:DIRECTION - GB:GENE pgsC GB:PRODUCT capsular polyglutamate amide ligase/translocase subunit GB:FUNCTION 16.1: Circulate 16.8: Protect 16.13: Shape GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11606194, 11751809, 15849754, 16689787, 16850406; Product type e: enzyme GB:PROTEIN_ID CAB15606.1 GB:DB_XREF GOA:P96737 InterPro:IPR008338 SubtiList:BG12532 UniProtKB/Swiss-Prot:P96737 GB:GENE:GENE pgsC LENGTH 149 SQ:AASEQ MFGSDLYIALILGVLLSLIFAEKTGIVPAGLVVPGYLGLVFNQPVFILLVLLVSLLTYVIVKYGLSKFMILYGRRKFAAMLITGIVLKIAFDFLYPIVPFEIAEFRGIGIIVPGLIANTIQKQGLTITFGSTLLLSGATFAIMFVYYLI GT:EXON 1|1-149:0| SW:ID CAPC_BACSU SW:DE RecName: Full=PGA biosynthesis protein capC; SW:GN Name=capC; Synonyms=pgsC, ywtA; OrderedLocusNames=BSU35890; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|CAPC_BACSU|6e-69|100.0|149/149| TM:NTM 5 TM:REGION 1->23| TM:REGION 25->47| TM:REGION 51->72| TM:REGION 88->110| TM:REGION 126->148| SEG 45->61|vfillvllvslltyviv| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11----1-------1111-------1--------------------------1111-------------------------------------------------------------------------------------------------------11-----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 148-150| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHccccccHHHHHEEccEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHc //