[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ptsH
DDBJ      :ptsH         histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein)
Swiss-Prot:PTHP_BACSU   RecName: Full=Phosphocarrier protein HPr;         EC=2.7.11.-;AltName: Full=Histidine-containing protein;

Homologs  Archaea  1/68 : Bacteria  496/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.94.1
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->88 1hid- PDBj 5e-45 100.0 %
:RPS:PDB   1->84 1cm2A PDBj 6e-20 33.3 %
:RPS:SCOP  1->84 1cm2A  d.94.1.1 * 6e-20 33.3 %
:HMM:SCOP  1->85 1opdA_ d.94.1.1 * 4e-26 45.9 %
:RPS:PFM   13->84 PF00381 * PTS-HPr 4e-16 61.1 %
:HMM:PFM   1->83 PF00381 * PTS-HPr 1e-34 48.2 83/84  
:BLT:SWISS 1->88 PTHP_BACSU 4e-45 100.0 %
:PROS 41->56|PS00012|PHOSPHOPANTETHEINE
:PROS 13->20|PS00369|PTS_HPR_HIS
:PROS 39->54|PS00589|PTS_HPR_SER

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13263.1 GT:GENE ptsH GT:PRODUCT histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1459384..1459650 GB:FROM 1459384 GB:TO 1459650 GB:DIRECTION + GB:GENE ptsH GB:PRODUCT histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein) GB:FUNCTION 16.3: Control 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10217795, 12411438, 14527945, 15126459, 16267306, 17085448, 17142398; Product type f: factor GB:PROTEIN_ID CAB13263.1 GB:DB_XREF GOA:P08877 InterPro:IPR002114 PDB:1JEM SubtiList:BG10200 UniProtKB/Swiss-Prot:P08877 GB:GENE:GENE ptsH LENGTH 88 SQ:AASEQ MAQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEETMKSEGLGE GT:EXON 1|1-88:0| SW:ID PTHP_BACSU SW:DE RecName: Full=Phosphocarrier protein HPr; EC=2.7.11.-;AltName: Full=Histidine-containing protein; SW:GN Name=ptsH; OrderedLocusNames=BSU13900; SW:KW 3D-structure; Complete proteome; Cytoplasm; Direct protein sequencing;Kinase; Phosphoprotein; Phosphotransferase system; Sugar transport;Transcription; Transcription regulation; Transferase; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|PTHP_BACSU|4e-45|100.0|88/88| GO:SWS:NREP 8 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|Phosphotransferase system| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 41->56|PS00012|PHOSPHOPANTETHEINE|PDOC00012| PROS 13->20|PS00369|PTS_HPR_HIS|PDOC00318| PROS 39->54|PS00589|PTS_HPR_SER|PDOC00318| BL:PDB:NREP 1 BL:PDB:REP 2->88|1hid-|5e-45|100.0|87/87| RP:PDB:NREP 1 RP:PDB:REP 1->84|1cm2A|6e-20|33.3|84/85| RP:PFM:NREP 1 RP:PFM:REP 13->84|PF00381|4e-16|61.1|72/83|PTS-HPr| HM:PFM:NREP 1 HM:PFM:REP 1->83|PF00381|1e-34|48.2|83/84|PTS-HPr| GO:PFM:NREP 2 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00381|IPR005698| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00381|IPR005698| RP:SCP:NREP 1 RP:SCP:REP 1->84|1cm2A|6e-20|33.3|84/85|d.94.1.1| HM:SCP:REP 1->85|1opdA_|4e-26|45.9|85/85|d.94.1.1|1/1|HPr-like| OP:NHOMO 647 OP:NHOMOORG 499 OP:PATTERN ----------------1--------------------------------------------------- ----1-----------------------------------------1--22--21--------1------------111-------------------------------1------11-11112111111111111-----------------------------------------------1---1-232222222222222222222222222222232111111116211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121-111111111111111121112-221-221----1--3--111121--1-1-----1-111---1--11-111-------------------111--1-----1---111--------------------------------------------------------------1--111111111111111111111111111111111--1111--11------11-111121111111111111--------1--1--1-11111111-1111111----------------------------112-----1-21111111-111111-11111--1-1111-11121222212222222122-2212222222223221223---221212222222222222222222222221-122222222222111-111111111----11-1211-11121111-----------------1---------------------2222222222222211111111111111----111111---1-111112----1-1-1-1--11111-111111-----1----121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcccTTcccHHHHHHHHHHHTTcccEEEEEETTEEEETTcHHHHTTccccTTcEEEEEEEcTTHHHHHHHHHHHHHHccccc DISOP:02AL 88-89| PSIPRED ccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccEEEEHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHccccc //