[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rapF
DDBJ      :rapF         response regulator aspartate phosphatase
Swiss-Prot:RAPF_BACSU   RecName: Full=Response regulator aspartate phosphatase F;         EC=3.1.-.-;

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  6/199 : Viruses  1/175   --->[See Alignment]
a.118.8
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   148->289 2fo7A PDBj 1e-09 24.6 %
:RPS:PDB   143->364 2cg3A PDBj 4e-12 7.3 %
:RPS:SCOP  43->321 1hz4A  a.118.8.2 * 2e-11 7.0 %
:HMM:SCOP  75->308 1qqeA_ a.118.8.1 * 4e-17 19.9 %
:HMM:PFM   191->211 PF07719 * TPR_2 0.00013 33.3 21/34  
:HMM:PFM   223->251 PF00515 * TPR_1 2.4e-09 31.0 29/34  
:BLT:SWISS 1->381 RAPF_BACSU 0.0 100.0 %
:REPEAT 2|85->178|211->292

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15773.1 GT:GENE rapF GT:PRODUCT response regulator aspartate phosphatase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3846001..3847146 GB:FROM 3846001 GB:TO 3847146 GB:DIRECTION + GB:GENE rapF GB:PRODUCT response regulator aspartate phosphatase GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15968044, 16816200; Product type e: enzyme GB:PROTEIN_ID CAB15773.1 GB:DB_XREF GOA:P71002 InterPro:IPR019734 SubtiList:BG11968 UniProtKB/Swiss-Prot:P71002 GB:GENE:GENE rapF LENGTH 381 SQ:AASEQ MTGVISSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGVSLYEIEV GT:EXON 1|1-381:0| SW:ID RAPF_BACSU SW:DE RecName: Full=Response regulator aspartate phosphatase F; EC=3.1.-.-; SW:GN Name=rapF; Synonyms=ywhJ; OrderedLocusNames=BSU37460; SW:KW Complete proteome; Hydrolase; Protein phosphatase; Repeat; TPR repeat. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->381|RAPF_BACSU|0.0|100.0|381/381| GO:SWS:NREP 2 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004721|"GO:phosphoprotein phosphatase activity"|Protein phosphatase| NREPEAT 1 REPEAT 2|85->178|211->292| BL:PDB:NREP 1 BL:PDB:REP 148->289|2fo7A|1e-09|24.6|130/136| RP:PDB:NREP 1 RP:PDB:REP 143->364|2cg3A|4e-12|7.3|206/617| HM:PFM:NREP 2 HM:PFM:REP 191->211|PF07719|0.00013|33.3|21/34|TPR_2| HM:PFM:REP 223->251|PF00515|2.4e-09|31.0|29/34|TPR_1| RP:SCP:NREP 1 RP:SCP:REP 43->321|1hz4A|2e-11|7.0|273/366|a.118.8.2| HM:SCP:REP 75->308|1qqeA_|4e-17|19.9|231/290|a.118.8.1|1/1|TPR-like| OP:NHOMO 198 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1--------------------------1------------1-1-12----------------13----------------------945556555866658785DBDB565----2-------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------11------------------------------11-1--------------5------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------- STR:NPRED 359 STR:RPRED 94.2 SQ:SECSTR #############HHHHHTTcccccHHHHHHHHHHHTccHHHHHHHTTTccTTccHHHHHHHHHHHHHHcGGGHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccGGGTccccHHHHHHHHHHHTcHHHHHHHHHHHHHTTcHHHHHHHHHHHHTcTTHHHcTTTcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHTTHHHHHHHccccccccHHHHHHcHHHHHHHHHHHccHHHHTTccEETTTTEEEEEEEETTEEEEEETcccTTccEEEEccHHHHEEEEHHHHTTcccHHHHHTTccEEETTcEEEEE######### DISOP:02AL 1-2| PSIPRED ccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHccc //