[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rbsC
DDBJ      :rbsC         ribose ABC transporter (permease)
Swiss-Prot:RBSC_BACSU   RecName: Full=Ribose transport system permease protein rbsC;

Homologs  Archaea  4/68 : Bacteria  400/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:322 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   48->260 PF02653 * BPD_transp_2 5e-15 38.2 %
:HMM:PFM   47->314 PF02653 * BPD_transp_2 4.5e-57 35.2 261/267  
:BLT:SWISS 1->322 RBSC_BACSU e-145 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15612.1 GT:GENE rbsC GT:PRODUCT ribose ABC transporter (permease) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3705165..3706133 GB:FROM 3705165 GB:TO 3706133 GB:DIRECTION + GB:GENE rbsC GB:PRODUCT ribose ABC transporter (permease) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15849754, 16850406, 7921236; Product type t: transporter GB:PROTEIN_ID CAB15612.1 GB:DB_XREF GOA:P36948 InterPro:IPR001851 SubtiList:BG10880 UniProtKB/Swiss-Prot:P36948 GB:GENE:GENE rbsC LENGTH 322 SQ:AASEQ MKTEQLQTEQKRIHFDGVMQKLGPFLGLFILVIIVSILNPSFLEPLNILNLLRQVAINGLIAFGMTFVILTGGIDLSVGAILALSSALVAGMIVSGVDPVLAIILGCIIGAVLGMINGLLITKGKMAPFIATLATMTVFRGLTLVYTDGNPITGLGTNYGFQMFGRGYFLGIPVPAITMVLAFVILWVLLHKTPFGRRTYAIGGNEKAALISGIKVTRVKVMIYSLAGLLSALAGAILTSRLHSAQPTAGESYELDAIAAVVLGGTSLSGGRGRIVGTLIGVLIIGTLNNGLNLLGVSSFYQLVVKGIVILIAVLLDRKKSA GT:EXON 1|1-322:0| SW:ID RBSC_BACSU SW:DE RecName: Full=Ribose transport system permease protein rbsC; SW:GN Name=rbsC; OrderedLocusNames=BSU35950; SW:KW Cell membrane; Complete proteome; Membrane; Sugar transport;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->322|RBSC_BACSU|e-145|100.0|322/322| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 8 TM:REGION 20->42| TM:REGION 46->68| TM:REGION 72->94| TM:REGION 100->122| TM:REGION 171->193| TM:REGION 221->243| TM:REGION 260->282| TM:REGION 295->317| SEG 225->236|slagllsalaga| SEG 261->297|vvlggtslsggrgrivgtligvliigtlnnglnllgv| RP:PFM:NREP 1 RP:PFM:REP 48->260|PF02653|5e-15|38.2|212/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 47->314|PF02653|4.5e-57|35.2|261/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 2251 OP:NHOMOORG 407 OP:PATTERN -------11-1-----1--------------------------------------------------- -122A111111-1--------111-9-------111-18432-1321-3531535-----1151324A561-----331---7------------------------2-2--------------------------33324---43--------------------11-21------------34---55-431333324331343335232221332154-122------36------------------11-1--11----------1----1-1-1111-1-1------------------------------------124--6-----1-11142--12227321-1-11----11231-3413421---4-11------3-9AB--------6677677577L------1-15S--VLLIPIWWYPXX11---7977277532--------H881---6------------------------------------11--C99A9B75555AAKF87773788G-31---4425-3--41149P-------11---------------1--1----1------------------9-----------------------------357--2----4----2--52222--2-2---------------96892B6ACC9AA7B9B-CA9CA7ABABCAB99AAAAFEF891114244444444444434B85687862-BLLLMLLIKLMM-----------1---22B333634-235348C7----------221111-138------667----------11162222212122-----------------1--------------11--------------1111---1----1131-26272-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcc //