[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rbsD
DDBJ      :rbsD         ribose ABC transporter (membrane bound ribose binding)
Swiss-Prot:RBSD_BACSU   RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;

Homologs  Archaea  0/68 : Bacteria  237/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.133.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->131 1ogdA PDBj 4e-71 100.0 %
:RPS:PDB   1->131 3e7nB PDBj 6e-42 46.1 %
:RPS:SCOP  1->131 1ogcA  c.133.1.1 * 3e-20 100.0 %
:HMM:SCOP  1->131 1ogcA_ c.133.1.1 * 1.4e-45 51.9 %
:RPS:PFM   1->130 PF05025 * RbsD_FucU 3e-27 53.8 %
:HMM:PFM   1->131 PF05025 * RbsD_FucU 2.1e-48 52.7 131/142  
:BLT:SWISS 1->131 RBSD_BACSU 1e-70 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15610.1 GT:GENE rbsD GT:PRODUCT ribose ABC transporter (membrane bound ribose binding) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3703271..3703666 GB:FROM 3703271 GB:TO 3703666 GB:DIRECTION + GB:GENE rbsD GB:PRODUCT ribose ABC transporter (membrane bound ribose binding) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 7921236; Product type t : transporter GB:PROTEIN_ID CAB15610.1 GB:DB_XREF GOA:P36946 InterPro:IPR007721 PDB:1OGC SubtiList:BG10878 UniProtKB/Swiss-Prot:P36946 GB:GENE:GENE rbsD LENGTH 131 SQ:AASEQ MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPYANCILQAGVLF GT:EXON 1|1-131:0| SW:ID RBSD_BACSU SW:DE RecName: Full=D-ribose pyranase; EC=5.5.1.n1; SW:GN Name=rbsD; OrderedLocusNames=BSU35930; SW:KW 3D-structure; Carbohydrate metabolism; Complete proteome; Cytoplasm;Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|RBSD_BACSU|1e-70|100.0|131/131| GO:SWS:NREP 3 GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| BL:PDB:NREP 1 BL:PDB:REP 1->131|1ogdA|4e-71|100.0|131/131| RP:PDB:NREP 1 RP:PDB:REP 1->131|3e7nB|6e-42|46.1|128/137| RP:PFM:NREP 1 RP:PFM:REP 1->130|PF05025|3e-27|53.8|130/135|RbsD_FucU| HM:PFM:NREP 1 HM:PFM:REP 1->131|PF05025|2.1e-48|52.7|131/142|RbsD_FucU| GO:PFM:NREP 1 GO:PFM GO:0008643|"GO:carbohydrate transport"|PF05025|IPR007721| RP:SCP:NREP 1 RP:SCP:REP 1->131|1ogcA|3e-20|100.0|131/131|c.133.1.1| HM:SCP:REP 1->131|1ogcA_|1.4e-45|51.9|131/131|c.133.1.1|1/1|Ribose transport protein RbsD| OP:NHOMO 250 OP:NHOMOORG 237 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------1---112------------2-----------------------------------------------------1------------------------------------------------------111111111111111111111111111-11-111-------111111111111111111111111-11-11-11111-11-1--111111111-1------------------------------------1------------1-1----1111-111-1--1----1---1--111-1----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1--------11-----------------------1------------------------------------------------112-------1-------1------1-----------------11111111111111111-11111111111111-11-1111111111111111111111111111-1111--122222212222------------------1111---11111111----------------1111-1111-111----------11111111111111-------------------------------------------------------1-----111--1111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 100.0 SQ:SECSTR ccccccccHHHHHHHHHccTTcEEEEEcTTccccTTcEEEEccccTTcccHHHHHHHHHHHHcEEEEEEETHHHHHcHHHHHHHHHHTcccEEEEEcHHHHHHHHTTccEEEEcccccTTccEEEEEcccc DISOP:02AL 131-132| PSIPRED ccccccccHHHHHHHHHHccccEEEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHcccccccHHHcccccHHHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEcccccccEEEEEEEcccc //