[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : recF
DDBJ      :recF         DNA repair and genetic recombination factor
Swiss-Prot:RECF_BACSU   RecName: Full=DNA replication and repair protein recF;

Homologs  Archaea  0/68 : Bacteria  658/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:370 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->361 2o5vA PDBj 9e-27 29.9 %
:RPS:PDB   1->102 1e69A PDBj 2e-08 16.7 %
:RPS:SCOP  1->103 1ii8.1  c.37.1.12 * 1e-13 18.4 %
:HMM:SCOP  1->352 1w1wA_ c.37.1.12 * 1.2e-42 25.6 %
:RPS:PFM   3->188 PF02463 * SMC_N 6e-04 28.2 %
:HMM:PFM   2->363 PF02463 * SMC_N 8.4e-22 24.4 193/220  
:BLT:SWISS 1->370 RECF_BACSU 0.0 100.0 %
:PROS 116->136|PS00617|RECF_1
:PROS 312->330|PS00618|RECF_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11780.1 GT:GENE recF GT:PRODUCT DNA repair and genetic recombination factor GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3437..4549 GB:FROM 3437 GB:TO 4549 GB:DIRECTION + GB:GENE recF GB:PRODUCT DNA repair and genetic recombination factor GB:FUNCTION 16.6: Maintain 16.9: Replicate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15186413, 16061691, 16385024; Product type f: factor GB:PROTEIN_ID CAB11780.1 GB:DB_XREF GOA:P05651 InterPro:IPR003395 SubtiList:BG10068 UniProtKB/Swiss-Prot:P05651 GB:GENE:GENE recF LENGTH 370 SQ:AASEQ MYIQNLELTSYRNYDHAELQFENKVNVIIGENAQGKTNLMEAIYVLSMAKSHRTSNDKELIRWDKDYAKIEGRVMKQNGAIPMQLVISKKGKKGKVNHIEQQKLSQYVGALNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQVSPVYLHDLSLYQKILSQRNHFLKQLQTRKQTDRTMLDVLTDQLVEVAAKVVVKRLQFTAQLEKWAQPIHAGISRGLEELTLKYHTALDVSDPLDLSKIGDSYQEAFSKLREKEIERGVTLSGPHRDDVLFYVNGRDVQTYGSQGQQRTTALSLKLAEIDLIHEEIGEYPILLLDDVLSELDDYRQSHLLHTIQGRVQTFVTTTSVDGIDHETLRQAGMFRVQNGALVK GT:EXON 1|1-370:0| SW:ID RECF_BACSU SW:DE RecName: Full=DNA replication and repair protein recF; SW:GN Name=recF; OrderedLocusNames=BSU00040; SW:KW ATP-binding; Complete proteome; Cytoplasm; DNA damage; DNA repair;DNA replication; DNA-binding; Nucleotide-binding; SOS response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->370|RECF_BACSU|0.0|100.0|370/370| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009432|"GO:SOS response"|SOS response| PROS 116->136|PS00617|RECF_1|PDOC00539| PROS 312->330|PS00618|RECF_2|PDOC00539| SEG 313->324|lllddvlseldd| BL:PDB:NREP 1 BL:PDB:REP 6->361|2o5vA|9e-27|29.9|334/358| RP:PDB:NREP 1 RP:PDB:REP 1->102|1e69A|2e-08|16.7|102/263| RP:PFM:NREP 1 RP:PFM:REP 3->188|PF02463|6e-04|28.2|177/536|SMC_N| HM:PFM:NREP 1 HM:PFM:REP 2->363|PF02463|8.4e-22|24.4|193/220|SMC_N| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 1 RP:SCP:REP 1->103|1ii8.1|1e-13|18.4|103/369|c.37.1.12| HM:SCP:REP 1->352|1w1wA_|1.2e-42|25.6|317/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 661 OP:NHOMOORG 658 OP:PATTERN -------------------------------------------------------------------- ----111111111111112-111111111111111111111111111111111111111111111111111111111111111-----111111111--111111111111111111111--1-11111111111111111---1111111111111111111111111111111111111111111122-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------11111------------------------------------1111111111111--1--1-111--11-11111111-11-1-----11111111--11111111111111-11-1---1-----------------------------------------------------------------------1--------------1111111111-1111-----------------------------11-111111111111111111111111111--11-11------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---11111111111--111111111111-11111111111111111111111111111111111111111111111111111111111111111111111--11111111---1-111111-------------------------1----------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 92.7 SQ:SECSTR cEEEEEEEEccTTccccEEEccccEEEEEccTTTccTHHHHHHHHTcccccTTcccccTTcccccEEEEEEEEEccccEEEEEEEEETTccEEEEETTEEEcGGGcccccHHEEEEcTTTTHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHT######TcGGGTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccEEEEEEcccc############TTTHHHHHHHTHHHHHHHTcccccGGGcEEEEEETTEEHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccGGGcccHHHHHHHHHHHHHccEEEEEEccccTTccEEEEETTEE######### DISOP:02AL 370-371| PSIPRED cEEEEEEEEcccEEHHEEEEccccEEEEEccccccHHHHHHHHHHHccccccccccHHHHHHccccEEEEEEEEEEcccEEEEEEEEEccccEEEEccccHHHHHHHHHHccEEEEccccHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccccEEEEcccEEcc //