[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : recR
DDBJ      :recR         DNA repair and recombination protein
Swiss-Prot:RECR_BACSU   RecName: Full=Recombination protein recR;

Homologs  Archaea  0/68 : Bacteria  873/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
e.49.1
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->196 1vddA PDBj 3e-56 52.6 %
:RPS:PDB   1->53 3cwsC PDBj 3e-04 20.8 %
:RPS:PDB   58->198 1cy7A PDBj 2e-37 18.6 %
:RPS:SCOP  1->198 1vddA  e.49.1.1 * 2e-46 51.5 %
:HMM:SCOP  1->198 1vddA_ e.49.1.1 * 7.9e-83 54.1 %
:RPS:PFM   44->78 PF02132 * RecR 2e-09 57.1 %
:HMM:PFM   39->78 PF02132 * RecR 1.5e-19 52.5 40/41  
:HMM:PFM   80->172 PF01751 * Toprim 4.7e-17 31.2 93/96  
:HMM:PFM   11->25 PF00633 * HHH 1.2e-05 53.3 15/30  
:BLT:SWISS 1->198 RECR_BACSU e-113 100.0 %
:PROS 57->78|PS01300|RECR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11797.1 GT:GENE recR GT:PRODUCT DNA repair and recombination protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 28867..29463 GB:FROM 28867 GB:TO 29463 GB:DIRECTION + GB:GENE recR GB:PRODUCT DNA repair and recombination protein GB:FUNCTION 16.6: Maintain GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12065426; Product type f: factor GB:PROTEIN_ID CAB11797.1 GB:DB_XREF GOA:P24277 InterPro:IPR015967 SubtiList:BG10085 UniProtKB/Swiss-Prot:P24277 GB:GENE:GENE recR LENGTH 198 SQ:AASEQ MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVCGHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPEDIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDLEYADEVTLSKALEGRREL GT:EXON 1|1-198:0| SW:ID RECR_BACSU SW:DE RecName: Full=Recombination protein recR; SW:GN Name=recR; Synonyms=recD, recM; OrderedLocusNames=BSU00210; SW:KW Complete proteome; DNA damage; DNA recombination; DNA repair;Metal-binding; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|RECR_BACSU|e-113|100.0|198/198| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 57->78|PS01300|RECR|PDOC01004| BL:PDB:NREP 1 BL:PDB:REP 1->196|1vddA|3e-56|52.6|194/199| RP:PDB:NREP 2 RP:PDB:REP 1->53|3cwsC|3e-04|20.8|53/281| RP:PDB:REP 58->198|1cy7A|2e-37|18.6|140/563| RP:PFM:NREP 1 RP:PFM:REP 44->78|PF02132|2e-09|57.1|35/41|RecR| HM:PFM:NREP 3 HM:PFM:REP 39->78|PF02132|1.5e-19|52.5|40/41|RecR| HM:PFM:REP 80->172|PF01751|4.7e-17|31.2|93/96|Toprim| HM:PFM:REP 11->25|PF00633|1.2e-05|53.3|15/30|HHH| GO:PFM:NREP 2 GO:PFM GO:0006281|"GO:DNA repair"|PF02132|IPR015967| GO:PFM GO:0006310|"GO:DNA recombination"|PF02132|IPR015967| RP:SCP:NREP 1 RP:SCP:REP 1->198|1vddA|2e-46|51.5|196/199|e.49.1.1| HM:SCP:REP 1->198|1vddA_|7.9e-83|54.1|196/199|e.49.1.1|1/1|Recombination protein RecR| OP:NHOMO 877 OP:NHOMOORG 875 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111-11111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111---1-111111---11-111111-111111-11111----------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 100.0 SQ:SECSTR cccccTTHHHHHHHTTcTTccHHHHHHHTTTTcccHHHHHHTGGGccHHHHHHHHTTEEEEEccHHHHHHHHTTccTTEEEEEcccccEEccccccHHHHHHHTEETTTTTEEccEEcTTTHHHHHHHHHHHHHTccEEEEcccccHHHHHHHHHHHHHHcccGGGEEEcccccccHHHHHHHccHHHHHHHHHHHHH DISOP:02AL 1-2, 197-198| PSIPRED ccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEcHHHHHHHHHccccccEEEEEccEEccccccccccccHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHHccccc //