[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : resB
DDBJ      :resB         factor required for cytochrome c synthesis
Swiss-Prot:RESB_BACSU   RecName: Full=Cytochrome c biogenesis protein resB;

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:542 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   190->302 2bhzA PDBj 3e-04 17.6 %
:RPS:PFM   63->518 PF05140 * ResB 2e-36 31.0 %
:HMM:PFM   63->519 PF05140 * ResB 1.6e-112 29.1 419/467  
:BLT:SWISS 1->542 RESB_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14246.1 GT:GENE resB GT:PRODUCT factor required for cytochrome c synthesis GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2419179..2420807) GB:FROM 2419179 GB:TO 2420807 GB:DIRECTION - GB:GENE resB GB:PRODUCT factor required for cytochrome c synthesis GB:FUNCTION 16.10: Respire GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10844653, 12682299, 16825793, 9395519; Product type f: factor GB:PROTEIN_ID CAB14246.1 GB:DB_XREF InterPro:IPR007816 SubtiList:BG10532 UniProtKB/Swiss-Prot:P35161 GB:GENE:GENE resB LENGTH 542 SQ:AASEQ MKQVKCECGHINPVGTVLCESCGRALQETQPPLADMRYDGSARRSQTYNKTIIDKIWNFFSSVKVGIWLIVITLAASAFGTIFPQEAYLPPGAQADTYYKEQYGTFGQLYYLLGFHHLYGSWWYLLLIASIGISLVICSLDRVIPLYRALKNQGVRRSPAFLRRQRLFSETVTVLNGESKEKIVTLLKKKHYRIREKEGSILAEKGRFSRWGPYVNHIGLIIFLIGAMLRFVPGMYVDETLWVREGETAAIPGTDGKYYLKNNQFSVETYNSKTEKKVFADAIDRVGDGRVAKNFQTDAVLYKREGKIVYGEKPKLEKVTEEDIRVNQPLRFDSFSVYQVDYKENQLDQMVFQLIDKKTKKSFGSLKINLLDPDSVYDLGNGYKVEIASYLPDFYFNQDGEPSTKTKIPNNPAFVFNIITPDKPKGEKSFVAIQETIEGSGNNKYKLKFDHVETKNITGLTVRKDLTLWVLAVGGAIFMIGVIQGMYWQHRRIWLHSQDGAVMVAGHTNKNWFGLKKDLAFILADSGLTEPVDQKELIKTQK GT:EXON 1|1-542:0| SW:ID RESB_BACSU SW:DE RecName: Full=Cytochrome c biogenesis protein resB; SW:GN Name=resB; Synonyms=ypxB; OrderedLocusNames=BSU23140; SW:KW Cell membrane; Complete proteome; Cytochrome c-type biogenesis;Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->542|RESB_BACSU|0.0|100.0|542/542| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0017004|"GO:cytochrome complex assembly"|Cytochrome c-type biogenesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 57->79| TM:REGION 119->141| TM:REGION 213->235| TM:REGION 466->488| SEG 109->120|lyyllgfhhlyg| RP:PDB:NREP 1 RP:PDB:REP 190->302|2bhzA|3e-04|17.6|102/581| RP:PFM:NREP 1 RP:PFM:REP 63->518|PF05140|2e-36|31.0|410/427|ResB| HM:PFM:NREP 1 HM:PFM:REP 63->519|PF05140|1.6e-112|29.1|419/467|ResB| OP:NHOMO 65 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- -1---------------------------------------------------------------------------------11-1--------------------------------------------------------------1111--11------1---111----------------------111111121111111111111111111111111------111---------------------------------------------------------------------------------------------------------------------2----11----------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------11---------------1111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 18.8 SQ:SECSTR #############################################################################################################################################################################################ccccGGGccEEEEcGGGEEEEEccccccEEEEETTEEEEEEEETTEE###########EEEEcccTTcEEEEEETTEEEcccTTccEEcccTTccccccTTcccccGGGccEE################################################################################################################################################################################################################################################ DISOP:02AL 32-50, 156-177, 527-542| PSIPRED cccccccccccccHHHHHHHHHcccccccccccEEEEcccHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHcccEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccEEEEcccccccEEEEcccEEEEcccccccEEEEEEEEEcccccccEEEEEEEEEEEccccEEEccccccccccEEEEEEcccEEEccEEEEEEEcccccEEEEEEEEccccccccccEEEccccccccccccccccEEEEEEcccEEEEcccccccccccccccHHHHHHEEccccccccEEEEEEccccccccccccEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHEEEEEEEEEEEEccEEEEEEEccHHHHHHHHHHHHHHHHHcccccccHHHHHHHcc //