[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rnpA
DDBJ      :rnpA         protein component of ribonuclease P (RNase P) (substrate specificity)
Swiss-Prot:RNPA_BACSU   RecName: Full=Ribonuclease P protein component;         Short=RNaseP protein;         Short=RNase P protein;         EC=3.1.26.5;AltName: Full=Protein C5;

Homologs  Archaea  0/68 : Bacteria  195/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->105 1a6fA PDBj 4e-56 99.0 %
:RPS:PDB   1->105 1a6fA PDBj 9e-24 99.0 %
:RPS:SCOP  1->105 1a6fA  d.14.1.2 * 6e-24 99.0 %
:HMM:SCOP  1->115 1d6tA_ d.14.1.2 * 2.4e-35 44.3 %
:RPS:PFM   1->105 PF00825 * Ribonuclease_P 3e-15 50.5 %
:HMM:PFM   1->106 PF00825 * Ribonuclease_P 1.7e-36 46.2 106/111  
:BLT:SWISS 1->105 RNPA_BACSU 5e-56 100.0 %
:PROS 51->65|PS00648|RIBONUCLEASE_P
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16142.1 GT:GENE rnpA GT:PRODUCT protein component of ribonuclease P (RNase P) (substrate specificity) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4214753..4215103) GB:FROM 4214753 GB:TO 4215103 GB:DIRECTION - GB:GENE rnpA GB:PRODUCT protein component of ribonuclease P (RNase P) (substrate specificity) GB:FUNCTION 16.6: Maintain 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299, 16061811, 16163391, 16980484, 17299131; Product type e: enzyme GB:PROTEIN_ID CAB16142.1 GB:DB_XREF GOA:P25814 InterPro:IPR014721 PDB:1A6F SubtiList:BG10063 UniProtKB/Swiss-Prot:P25814 GB:GENE:GENE rnpA LENGTH 116 SQ:AASEQ MKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKKSLQHLFRKSSLYKKSSSK GT:EXON 1|1-116:0| SW:ID RNPA_BACSU SW:DE RecName: Full=Ribonuclease P protein component; Short=RNaseP protein; Short=RNase P protein; EC=3.1.26.5;AltName: Full=Protein C5; SW:GN Name=rnpA; OrderedLocusNames=BSU41050; SW:KW 3D-structure; Complete proteome; Endonuclease; Hydrolase; Nuclease;RNA-binding; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->105|RNPA_BACSU|5e-56|100.0|105/116| GO:SWS:NREP 5 GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| PROS 51->65|PS00648|RIBONUCLEASE_P|PDOC00558| SEG 106->115|ksslykksss| BL:PDB:NREP 1 BL:PDB:REP 1->105|1a6fA|4e-56|99.0|105/113| RP:PDB:NREP 1 RP:PDB:REP 1->105|1a6fA|9e-24|99.0|105/113| RP:PFM:NREP 1 RP:PFM:REP 1->105|PF00825|3e-15|50.5|105/111|Ribonuclease_P| HM:PFM:NREP 1 HM:PFM:REP 1->106|PF00825|1.7e-36|46.2|106/111|Ribonuclease_P| GO:PFM:NREP 3 GO:PFM GO:0000049|"GO:tRNA binding"|PF00825|IPR000100| GO:PFM GO:0004526|"GO:ribonuclease P activity"|PF00825|IPR000100| GO:PFM GO:0008033|"GO:tRNA processing"|PF00825|IPR000100| RP:SCP:NREP 1 RP:SCP:REP 1->105|1a6fA|6e-24|99.0|105/113|d.14.1.2| HM:SCP:REP 1->115|1d6tA_|2.4e-35|44.3|115/117|d.14.1.2|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 196 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------11-----1---------------------------------------11-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-------1-111--1---1-1111111---11-111--11111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------111---1-1------1-------------------------111----------1-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------11111----------------1--------------------------1-1------1-------1--11---1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 90.5 SQ:SECSTR ccGGGccccHHHHHHHHHHcEEEEcccEEEEEcccTTccccEEEEEEccTTccHHHHHHHHHHHHHHHHHHTTTccccEEEEEEcGGGTTccHHHHHHHHHHHHH########### DISOP:02AL 108-109, 111-116| PSIPRED cccccccccHHHHHHHHHcccEEcccEEEEEEEEcccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccccc //