[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rocD
DDBJ      :rocD         ornithine aminotransferase
Swiss-Prot:OAT_BACSU    RecName: Full=Ornithine aminotransferase;         Short=OAT;         EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid aminotransferase;

Homologs  Archaea  67/68 : Bacteria  792/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->398 2oatA PDBj e-105 47.4 %
:RPS:PDB   6->399 2bylA PDBj e-104 49.2 %
:RPS:SCOP  6->399 1gbnA  c.67.1.4 * 4e-92 49.5 %
:HMM:SCOP  1->401 1qj5A_ c.67.1.4 * 5.8e-132 39.5 %
:RPS:PFM   28->350 PF00202 * Aminotran_3 2e-76 45.9 %
:HMM:PFM   29->349 PF00202 * Aminotran_3 9e-120 49.1 318/339  
:BLT:SWISS 1->401 OAT_BACSU 0.0 100.0 %
:PROS 226->263|PS00600|AA_TRANSFER_CLASS_3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16071.1 GT:GENE rocD GT:PRODUCT ornithine aminotransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4144301..4145506) GB:FROM 4144301 GB:TO 4145506 GB:DIRECTION - GB:GENE rocD GB:PRODUCT ornithine aminotransferase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 7540694, 9383188; Product type e: enzyme GB:PROTEIN_ID CAB16071.1 GB:DB_XREF GOA:P38021 HSSP:2OAT InterPro:IPR015421 SubtiList:BG10722 UniProtKB/Swiss-Prot:P38021 GB:GENE:GENE rocD LENGTH 401 SQ:AASEQ MTALSKSKEIIDQTSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAARRWAYEVKGVADNQAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAITPNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWDGIVPDMYILGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASLEVLEDEKLADRSLELGEYFKSELESIDSPVIKEVRGRGLFIGVELTEAARPYCERLKEEGLLCKETHDTVIRFAPPLIISKEDLDWAIEKIKHVLRNA GT:EXON 1|1-401:0| SW:ID OAT_BACSU SW:DE RecName: Full=Ornithine aminotransferase; Short=OAT; EC=2.6.1.13;AltName: Full=Ornithine--oxo-acid aminotransferase; SW:GN Name=rocD; OrderedLocusNames=BSU40340; SW:KW Amino-acid biosynthesis; Aminotransferase; Arginine metabolism;Complete proteome; Cytoplasm; Proline biosynthesis;Pyridoxal phosphate; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->401|OAT_BACSU|0.0|100.0|401/401| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0008483|"GO:transaminase activity"|Aminotransferase| GO:SWS GO:0006525|"GO:arginine metabolic process"|Arginine metabolism| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006561|"GO:proline biosynthetic process"|Proline biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 226->263|PS00600|AA_TRANSFER_CLASS_3|PDOC00519| BL:PDB:NREP 1 BL:PDB:REP 7->398|2oatA|e-105|47.4|392/404| RP:PDB:NREP 1 RP:PDB:REP 6->399|2bylA|e-104|49.2|394/404| RP:PFM:NREP 1 RP:PFM:REP 28->350|PF00202|2e-76|45.9|316/336|Aminotran_3| HM:PFM:NREP 1 HM:PFM:REP 29->349|PF00202|9e-120|49.1|318/339|Aminotran_3| GO:PFM:NREP 2 GO:PFM GO:0008483|"GO:transaminase activity"|PF00202|IPR005814| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00202|IPR005814| RP:SCP:NREP 1 RP:SCP:REP 6->399|1gbnA|4e-92|49.5|394/402|c.67.1.4| HM:SCP:REP 1->401|1qj5A_|5.8e-132|39.5|397/429|c.67.1.4|1/1|PLP-dependent transferases| OP:NHOMO 5642 OP:NHOMOORG 1049 OP:PATTERN 44221334555555541433333332242253222233333332232222343254523233228-46 49669434555342G7777-7C449H757778GBBB79FI79994444254574553511D6B3F6EEFE81111121-12263434423221322-115465768573711111112122222133333333333788981117942432243333343333324464823433333333336553411-86AAAAAA9999B9A9998B88889BC8667744333333A936666665666666656646-------2---2222-----231111-------121------------------------2--111----36256-------2-262663111313--522442243443333332322253366651111185B6A554666647899789798A-456447385L72EAADBAK99ECE6744259A98887AE44444444655234582222222222---------------2122214643BCCB9GIIGGHACCCAFFFHEEEE6DEFD66762377A698338596CA663333485333333344447426666354446334333343355433336856412333333322322222223433333764365A344795555666555555565851-1455321-22277A83787776766677-7777766777767777776ACA8B9C366665666666666667653666632445555455555--2322222444445698444323322223223888976745487DEDEBJBH9IFFC7BGF422222222554445666669655667676755533333332553333------------------------------------1222212111643 11--443-1---11348756684B7C577333344455542445455568FAFB3654556343736A93324375425566454534-46484447464483555-565A3747473434444753736V4-4444433644453444243354B5446CC4A565474H56454572e53367BCDL5877574959 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 401 STR:RPRED 100.0 SQ:SECSTR ccccccHHHHHHHHHHHcccccccccccEEEEEcTEEEETTccEEEEccHHHHTcTTccTcHHHHHHHHHHHTTcccccTTcccccHHHHHHHHHHHHTccEEEEEccHHHHHHHHHHHHHHHHHHTTcccTTccEEEEETTccccccHHHHTTcccHHHHTTcccccTTEEEEcTTcHHHHHHHHTTTEEEEEEccccTTTTcccccTTHHHHHHHHHHHHTcEEEEEcTTTTTTTTccccGGGGGTccccEEEEcGGGGTTccccEEEEEcHHHHTTccTTccccccTTcHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHTccTTTEEEEEEETTEEEEEEcccHHHHHHHHHHTTEEcEEEETTEEEEcccTTccHHHHHHHHHHHHHHHHcc DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHcccccccccEEEEEccccEEEEcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHEEEccccccccccccccccEEEEccccHHHHHHHHcccEEEEEEEEEccccccccccHHHHHHHHHHHHHcccEEEEEcccccccHHccccEEEccccEEEEEEEEHHHHccccEEEEEEEcHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEEEEEcccHHHHHHHHHHcccEEEEccccEEEEcccccccHHHHHHHHHHHHHHHHcc //