[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rplB
DDBJ      :rplB         ribosomal protein L2 (BL2)
Swiss-Prot:RL2_BACSU    RecName: Full=50S ribosomal protein L2;         Short=BL2;

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
b.34.5b.40.4
:277 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->274 3huxD PDBj 7e-88 57.7 %
:RPS:PDB   6->273 3bboE PDBj 3e-93 54.0 %
:RPS:SCOP  5->125 2hgjD2  b.40.4.5 * 5e-34 62.8 %
:RPS:SCOP  127->268 1s72A1  b.34.5.3 * 2e-32 36.2 %
:HMM:SCOP  38->126 1ffkA2 b.40.4.5 * 2.8e-33 67.4 %
:HMM:SCOP  127->269 1ffkA1 b.34.5.3 * 1.2e-60 67.6 %
:RPS:PFM   42->118 PF00181 * Ribosomal_L2 5e-25 70.1 %
:RPS:PFM   124->253 PF03947 * Ribosomal_L2_C 4e-43 72.9 %
:HMM:PFM   124->253 PF03947 * Ribosomal_L2_C 1.8e-61 72.3 130/130  
:HMM:PFM   42->118 PF00181 * Ribosomal_L2 2.8e-37 68.8 77/77  
:BLT:SWISS 1->277 RL2_BACSU e-162 100.0 %
:PROS 218->229|PS00467|RIBOSOMAL_L2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11895.2 GT:GENE rplB GT:PRODUCT ribosomal protein L2 (BL2) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 137311..138144 GB:FROM 137311 GB:TO 138144 GB:DIRECTION + GB:GENE rplB GB:PRODUCT ribosomal protein L2 (BL2) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB11895.2 GB:DB_XREF GOA:P42919 HSSP:1RL2 InterPro:IPR014722 SubtiList:BG11217 UniProtKB/Swiss-Prot:P42919 GB:GENE:GENE rplB LENGTH 277 SQ:AASEQ MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYILAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK GT:EXON 1|1-277:0| SW:ID RL2_BACSU SW:DE RecName: Full=50S ribosomal protein L2; Short=BL2; SW:GN Name=rplB; OrderedLocusNames=BSU01190; SW:KW Complete proteome; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->277|RL2_BACSU|e-162|100.0|277/277| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 218->229|PS00467|RIBOSOMAL_L2|PDOC00384| BL:PDB:NREP 1 BL:PDB:REP 2->274|3huxD|7e-88|57.7|272/273| RP:PDB:NREP 1 RP:PDB:REP 6->273|3bboE|3e-93|54.0|263/266| RP:PFM:NREP 2 RP:PFM:REP 42->118|PF00181|5e-25|70.1|77/77|Ribosomal_L2| RP:PFM:REP 124->253|PF03947|4e-43|72.9|129/129|Ribosomal_L2_C| HM:PFM:NREP 2 HM:PFM:REP 124->253|PF03947|1.8e-61|72.3|130/130|Ribosomal_L2_C| HM:PFM:REP 42->118|PF00181|2.8e-37|68.8|77/77|Ribosomal_L2| GO:PFM:NREP 8 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00181|IPR002171| GO:PFM GO:0005622|"GO:intracellular"|PF00181|IPR002171| GO:PFM GO:0005840|"GO:ribosome"|PF00181|IPR002171| GO:PFM GO:0006412|"GO:translation"|PF00181|IPR002171| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03947|IPR002171| GO:PFM GO:0005622|"GO:intracellular"|PF03947|IPR002171| GO:PFM GO:0005840|"GO:ribosome"|PF03947|IPR002171| GO:PFM GO:0006412|"GO:translation"|PF03947|IPR002171| RP:SCP:NREP 2 RP:SCP:REP 5->125|2hgjD2|5e-34|62.8|121/122|b.40.4.5| RP:SCP:REP 127->268|1s72A1|2e-32|36.2|141/147|b.34.5.3| HM:SCP:REP 38->126|1ffkA2|2.8e-33|67.4|89/90|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 127->269|1ffkA1|1.2e-60|67.6|142/0|b.34.5.3|1/1|Translation proteins SH3-like domain| OP:NHOMO 1465 OP:NHOMOORG 1172 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 23111111A4312222212122222122222222222412222222222222222221222221322212211331311122221134-23222222222221545113142322232121222342425D3-23512-222233-221122122243136222231322312233222Q22222646L2631111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 98.9 SQ:SECSTR #ccccccccccccccccccccTcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEGGGccccccccccccccccccccccTTTccccccccccTTccccccTTcccccccccEEccccccccHHHHccccccccccTTTcccccccccccTTTcccccccccccTTccccccccccccccccccccccccccccccccc## PSIPRED cccccccccccccccEEEEcccccccccccccEEEEcccccccccccEEEEEEccccccccEEEEEEEEcccccEEEEEEEEEccccccEEEEEEcccccEEEEEcccccccccEEEEccccccccccEEEHHHcccccEEEEEEEcccccEEEEEEcccEEEEEEEcccEEEEEcccccEEEEccccEEEEEEEcccccccccHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEccccc //