[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rplC
DDBJ      :rplC         ribosomal protein L3 (BL3)
Swiss-Prot:RL3_BACSU    RecName: Full=50S ribosomal protein L3;         Short=BL3;

Homologs  Archaea  49/68 : Bacteria  907/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
b.43.3
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->208 2zjrB PDBj 6e-57 54.2 %
:RPS:PDB   57->207 3bboF PDBj 3e-11 42.4 %
:RPS:SCOP  3->208 1vs6D1  b.43.3.2 * 2e-74 51.0 %
:HMM:SCOP  1->211 1ffkB_ b.43.3.2 * 3e-84 52.6 %
:RPS:PFM   9->203 PF00297 * Ribosomal_L3 6e-46 55.4 %
:HMM:PFM   9->203 PF00297 * Ribosomal_L3 2.4e-55 43.1 195/263  
:BLT:SWISS 1->209 RL3_BACSU e-117 100.0 %
:PROS 102->125|PS00474|RIBOSOMAL_L3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11892.1 GT:GENE rplC GT:PRODUCT ribosomal protein L3 (BL3) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 135712..136341 GB:FROM 135712 GB:TO 136341 GB:DIRECTION + GB:GENE rplC GB:PRODUCT ribosomal protein L3 (BL3) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB11892.1 GB:DB_XREF GOA:P42920 InterPro:IPR019926 SubtiList:BG11218 UniProtKB/Swiss-Prot:P42920 GB:GENE:GENE rplC LENGTH 209 SQ:AASEQ MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDGYEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGRMGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK GT:EXON 1|1-209:0| SW:ID RL3_BACSU SW:DE RecName: Full=50S ribosomal protein L3; Short=BL3; SW:GN Name=rplC; OrderedLocusNames=BSU01160; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->209|RL3_BACSU|e-117|100.0|209/209| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 102->125|PS00474|RIBOSOMAL_L3|PDOC00385| BL:PDB:NREP 1 BL:PDB:REP 3->208|2zjrB|6e-57|54.2|201/205| RP:PDB:NREP 1 RP:PDB:REP 57->207|3bboF|3e-11|42.4|151/154| RP:PFM:NREP 1 RP:PFM:REP 9->203|PF00297|6e-46|55.4|195/196|Ribosomal_L3| HM:PFM:NREP 1 HM:PFM:REP 9->203|PF00297|2.4e-55|43.1|195/263|Ribosomal_L3| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00297|IPR000597| GO:PFM GO:0005622|"GO:intracellular"|PF00297|IPR000597| GO:PFM GO:0005840|"GO:ribosome"|PF00297|IPR000597| GO:PFM GO:0006412|"GO:translation"|PF00297|IPR000597| RP:SCP:NREP 1 RP:SCP:REP 3->208|1vs6D1|2e-74|51.0|206/209|b.43.3.2| HM:SCP:REP 1->211|1ffkB_|3e-84|52.6|211/337|b.43.3.2|1/1|Translation proteins| OP:NHOMO 1208 OP:NHOMOORG 1135 OP:PATTERN -----1--111111-1111111111111111111111111111--111-1--111-1----111-111 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111-1111111111111111111111111111112111111211111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 22--111-411-1111111111111111111111111111111111111111111111111-111111-1111111111111111111-12111111111111111-1212221121--1111-11-1-241-112111-1-111111111-12-1111-111111-111111222122S2222232431221131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 98.6 SQ:SECSTR ##cEEEEEEEEEEEEETETTEEEEEEEEEcccEEEEEEEcTTTTcccEEEEEccccccccccHHHHTTcccccccccccccccccccccTTTTcccccccccccccccccccccccccccccccccccccccccccccTTTccccccccccTTTTTTccccccccccccccccccEEEEETTTTEEEEcccccccccccccccccccc# DISOP:02AL 129-143, 208-209| PSIPRED ccEEEEEEEEcccEEEcccccEEEEEEEEEccEEEEEEEEccccccEEEEEEEccEEEEEEcHHHHHHHHHHccccccEEEEEEEccccccccccEEEEEEEccccEEEEEEEEccccEEccEEEcccccccccccccccccEEEEccccccEEEcccccccccccEEEEEEEEEEEEEcccccEEEEEcccccccccEEEEEcHHHcc //