[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rplF
DDBJ      :rplF         ribosomal protein L6 (BL8)
Swiss-Prot:RL6_BACSU    RecName: Full=50S ribosomal protein L6;AltName: Full=BL10;

Homologs  Archaea  14/68 : Bacteria  909/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
d.141.1
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->171 1rl6A PDBj 2e-59 84.7 %
:RPS:PDB   1->179 3bboI PDBj 5e-50 45.5 %
:RPS:SCOP  10->83 1rl6A1  d.141.1.1 * 3e-25 82.2 %
:RPS:SCOP  84->171 1rl6A2  d.141.1.1 * 2e-29 67.0 %
:HMM:SCOP  5->83 1ffk11 d.141.1.1 * 2.2e-21 50.0 %
:HMM:SCOP  84->172 1rl6A2 d.141.1.1 * 6.8e-30 61.8 %
:RPS:PFM   11->83 PF00347 * Ribosomal_L6 7e-04 44.0 %
:RPS:PFM   130->165 PF00347 * Ribosomal_L6 5e-04 62.5 %
:HMM:PFM   11->83 PF00347 * Ribosomal_L6 4.8e-26 48.6 72/77  
:HMM:PFM   91->165 PF00347 * Ribosomal_L6 1.6e-24 36.1 72/77  
:BLT:SWISS 1->179 RL6_BACSU 4e-89 100.0 %
:PROS 155->163|PS00525|RIBOSOMAL_L6_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11907.1 GT:GENE rplF GT:PRODUCT ribosomal protein L6 (BL8) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 142402..142941 GB:FROM 142402 GB:TO 142941 GB:DIRECTION + GB:GENE rplF GB:PRODUCT ribosomal protein L6 (BL8) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB11907.1 GB:DB_XREF GOA:P46898 HSSP:1C04 InterPro:IPR019906 SubtiList:BG11408 UniProtKB/Swiss-Prot:P46898 GB:GENE:GENE rplF LENGTH 179 SQ:AASEQ MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRRKEGKSAK GT:EXON 1|1-179:0| SW:ID RL6_BACSU SW:DE RecName: Full=50S ribosomal protein L6;AltName: Full=BL10; SW:GN Name=rplF; OrderedLocusNames=BSU01310; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->179|RL6_BACSU|4e-89|100.0|179/179| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 155->163|PS00525|RIBOSOMAL_L6_1|PDOC00454| SEG 113->127|pveivpeegieievp| BL:PDB:NREP 1 BL:PDB:REP 28->171|1rl6A|2e-59|84.7|144/164| RP:PDB:NREP 1 RP:PDB:REP 1->179|3bboI|5e-50|45.5|178/182| RP:PFM:NREP 2 RP:PFM:REP 11->83|PF00347|7e-04|44.0|72/74|Ribosomal_L6| RP:PFM:REP 130->165|PF00347|5e-04|62.5|32/74|Ribosomal_L6| HM:PFM:NREP 2 HM:PFM:REP 11->83|PF00347|4.8e-26|48.6|72/77|Ribosomal_L6| HM:PFM:REP 91->165|PF00347|1.6e-24|36.1|72/77|Ribosomal_L6| GO:PFM:NREP 8 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00347|IPR020040| GO:PFM GO:0005840|"GO:ribosome"|PF00347|IPR020040| GO:PFM GO:0006412|"GO:translation"|PF00347|IPR020040| GO:PFM GO:0019843|"GO:rRNA binding"|PF00347|IPR020040| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00347|IPR020040| GO:PFM GO:0005840|"GO:ribosome"|PF00347|IPR020040| GO:PFM GO:0006412|"GO:translation"|PF00347|IPR020040| GO:PFM GO:0019843|"GO:rRNA binding"|PF00347|IPR020040| RP:SCP:NREP 2 RP:SCP:REP 10->83|1rl6A1|3e-25|82.2|73/75|d.141.1.1| RP:SCP:REP 84->171|1rl6A2|2e-29|67.0|88/89|d.141.1.1| HM:SCP:REP 5->83|1ffk11|2.2e-21|50.0|78/79|d.141.1.1|1/1|Ribosomal protein L6| HM:SCP:REP 84->172|1rl6A2|6.8e-30|61.8|89/89|d.141.1.1|1/1|Ribosomal protein L6| OP:NHOMO 1064 OP:NHOMOORG 1027 OP:PATTERN ------------------------------11-1-------1---11-11-11111---1-------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------11111111111111-111111111-111111111-1111111-1111---111111-11-1111111111111111-12111111111111111--2------------------------------------------------------1----------11111H111122465122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 100.0 SQ:SECSTR ccccccccccccTTccEEEccccEEEEccccccEEEEcccccEEEcccccEEEEcccccTTHHHHHHHHTTTTTHHHHHTTTcEEEcEEcccTTccEEEcccEEEEcccccccEEEEccccEEEEcccTTccEEEEcccHHHHHHHHHTTccccccTTTccccEETTcccccccccccc DISOP:02AL 177-179| PSIPRED ccccccEEEEcccccEEEEEcccEEEEEcccEEEEEEccccEEEEEEccEEEEEEccccHHHHHHHHHHHHHHHccEEEEEcccEEEEEEEEEccEEEEEccEEEEEEcccEEEEEEcccccEEEEccccEEEEEEccHHHHHHHHHHHHccccccccccccEEEcccEEEEccccccc //