[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rplJ
DDBJ      :rplJ         ribosomal protein L10 (BL5)
Swiss-Prot:RL10_BACSU   RecName: Full=50S ribosomal protein L10;AltName: Full=BL5;AltName: Full=Cold acclimatization protein;         Short=CAP;AltName: Full=Vegetative protein 300;         Short=VEG300;

Homologs  Archaea  0/68 : Bacteria  877/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.58.62
:166 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->147 1zaxA PDBj 3e-20 35.2 %
:RPS:SCOP  4->149 1zavA1  d.58.62.1 * 7e-29 34.2 %
:RPS:PFM   6->99 PF00466 * Ribosomal_L10 5e-17 52.1 %
:HMM:PFM   6->101 PF00466 * Ribosomal_L10 5.3e-33 46.9 96/100  
:BLT:SWISS 1->149 RL10_BACSU 6e-78 100.0 %
:PROS 8->42|PS01109|RIBOSOMAL_L10
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11880.2 GT:GENE rplJ GT:PRODUCT ribosomal protein L10 (BL5) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 120061..120561 GB:FROM 120061 GB:TO 120561 GB:DIRECTION + GB:GENE rplJ GB:PRODUCT ribosomal protein L10 (BL5) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11341315, 12682299, 9810686; Product type s: structure GB:PROTEIN_ID CAB11880.2 GB:DB_XREF GOA:P42923 InterPro:IPR002363 SubtiList:BG11220 UniProtKB/Swiss-Prot:P42923 GB:GENE:GENE rplJ LENGTH 166 SQ:AASEQ MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHEALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALAAKAVAEQKEEQGA GT:EXON 1|1-166:0| SW:ID RL10_BACSU SW:DE RecName: Full=50S ribosomal protein L10;AltName: Full=BL5;AltName: Full=Cold acclimatization protein; Short=CAP;AltName: Full=Vegetative protein 300; Short=VEG300; SW:GN Name=rplJ; OrderedLocusNames=BSU01040; SW:KW Complete proteome; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|RL10_BACSU|6e-78|100.0|149/166| GO:SWS:NREP 3 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 8->42|PS01109|RIBOSOMAL_L10|PDOC00853| SEG 150->165|lalaakavaeqkeeqg| BL:PDB:NREP 1 BL:PDB:REP 6->147|1zaxA|3e-20|35.2|142/174| RP:PFM:NREP 1 RP:PFM:REP 6->99|PF00466|5e-17|52.1|94/100|Ribosomal_L10| HM:PFM:NREP 1 HM:PFM:REP 6->101|PF00466|5.3e-33|46.9|96/100|Ribosomal_L10| GO:PFM:NREP 2 GO:PFM GO:0005622|"GO:intracellular"|PF00466|IPR001790| GO:PFM GO:0042254|"GO:ribosome biogenesis"|PF00466|IPR001790| RP:SCP:NREP 1 RP:SCP:REP 4->149|1zavA1|7e-29|34.2|146/177|d.58.62.1| OP:NHOMO 887 OP:NHOMOORG 883 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111---1--11111111111-------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-111111111111111111111111-11-211111111111111111111----------111111111111111----11111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-2111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 85.5 SQ:SECSTR #####cHHHHHHHHHHHHHTTccEEEEEccTTccHHHHHHHHHHHHHHGEEEEEccHHHHHHHHHHTTccccGGGGccccEEEEEccccHHHHHHHHHHHHHTTcGGEEEEEETTEEEETTHHHHHHTcccHHHHHHHHHHHHHHHH################### PSIPRED ccccHHHHHHHHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHccccHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEEccEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //