[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rplO
DDBJ      :rplO         ribosomal protein L15
Swiss-Prot:RL15_BACSU   RecName: Full=50S ribosomal protein L15;

Homologs  Archaea  0/68 : Bacteria  803/915 : Eukaryota  85/199 : Viruses  0/175   --->[See Alignment]
c.12.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->131 1vs9J PDBj 3e-26 55.9 %
:RPS:PDB   1->131 3bboN PDBj 2e-29 46.6 %
:RPS:SCOP  1->129 1vs6L1  c.12.1.1 * 5e-40 46.9 %
:HMM:SCOP  4->144 2gyaJ1 c.12.1.1 * 5e-52 64.3 %
:RPS:PFM   26->131 PF00828 * Ribosomal_L18e 2e-19 58.7 %
:HMM:PFM   27->145 PF00828 * Ribosomal_L18e 1.3e-36 44.8 116/129  
:BLT:SWISS 1->131 RL15_BACSU 7e-73 100.0 %
:PROS 110->140|PS00475|RIBOSOMAL_L15
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11911.1 GT:GENE rplO GT:PRODUCT ribosomal protein L15 GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 144085..144525 GB:FROM 144085 GB:TO 144525 GB:DIRECTION + GB:GENE rplO GB:PRODUCT ribosomal protein L15 GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12682299, 15855514; Product type s: structure GB:PROTEIN_ID CAB11911.1 GB:DB_XREF GOA:P19946 InterPro:IPR005749 SubtiList:BG10444 UniProtKB/Swiss-Prot:P19946 GB:GENE:GENE rplO LENGTH 146 SQ:AASEQ MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGFEGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISKLNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI GT:EXON 1|1-146:0| SW:ID RL15_BACSU SW:DE RecName: Full=50S ribosomal protein L15; SW:GN Name=rplO; OrderedLocusNames=BSU01350; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|RL15_BACSU|7e-73|100.0|131/146| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 110->140|PS00475|RIBOSOMAL_L15|PDOC00386| SEG 132->145|akeaveaaggtaev| BL:PDB:NREP 1 BL:PDB:REP 1->131|1vs9J|3e-26|55.9|127/147| RP:PDB:NREP 1 RP:PDB:REP 1->131|3bboN|2e-29|46.6|131/176| RP:PFM:NREP 1 RP:PFM:REP 26->131|PF00828|2e-19|58.7|104/129|Ribosomal_L18e| HM:PFM:NREP 1 HM:PFM:REP 27->145|PF00828|1.3e-36|44.8|116/129|Ribosomal_L18e| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00828|IPR000039| GO:PFM GO:0005622|"GO:intracellular"|PF00828|IPR000039| GO:PFM GO:0005840|"GO:ribosome"|PF00828|IPR000039| GO:PFM GO:0006412|"GO:translation"|PF00828|IPR000039| RP:SCP:NREP 1 RP:SCP:REP 1->129|1vs6L1|5e-40|46.9|128/144|c.12.1.1| HM:SCP:REP 4->144|2gyaJ1|5e-52|64.3|140/0|c.12.1.1|1/1|Ribosomal proteins L15p and L18e| OP:NHOMO 919 OP:NHOMOORG 888 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-111111111111111111111111111111111111111-1111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------11-----1--1111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-1111111111111111111111111-11-1-----1111111111111111111-1111111111111111111111111111-1111111-111-------------------------------------------------------------1---------11111111111111-1111111111111111--1---1----11-111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -----11---------1-----------1----1-1------------11111111111111-111111111111111-1111111-1--1111-11111-11111-12-------------------------------------------------1--------------112111E122225212-112112112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 89.7 SQ:SECSTR ccccccccccccccccccccccccccccccccccccccGGGTcccccTTcccccccTTcccccccccccccccccccccccccccTTTTTTcccccccccccccccccccccccccccccccccccccTGG############### DISOP:02AL 8-49| PSIPRED ccccccccccccccccEEcccccccccccccccccccccccccccccccEEEccEEHHHHccccccccccccEEEEEEHHHHHHHHccccccHHHHHHccccccccccEEEEEcccccccEEEEEEEccHHHHHHHHHcccEEEEc //