[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rplQ
DDBJ      :rplQ         ribosomal protein L17 (BL15)
Swiss-Prot:RL17_BACSU   RecName: Full=50S ribosomal protein L17;AltName: Full=BL15;AltName: Full=BL21;

Homologs  Archaea  0/68 : Bacteria  904/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
d.188.1
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->120 3bboP PDBj 1e-26 53.7 %
:RPS:PDB   2->120 3bboP PDBj 8e-43 52.3 %
:RPS:SCOP  10->120 1gd8A  d.188.1.1 * 2e-39 51.5 %
:HMM:SCOP  10->121 1gd8A_ d.188.1.1 * 1.8e-40 59.6 %
:RPS:PFM   16->120 PF01196 * Ribosomal_L17 2e-27 69.1 %
:HMM:PFM   16->120 PF01196 * Ribosomal_L17 2.6e-43 59.8 97/97  
:BLT:SWISS 1->120 RL17_BACSU 5e-64 100.0 %
:PROS 30->52|PS01167|RIBOSOMAL_L17

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11920.1 GT:GENE rplQ GT:PRODUCT ribosomal protein L17 (BL15) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 149953..150315 GB:FROM 149953 GB:TO 150315 GB:DIRECTION + GB:GENE rplQ GB:PRODUCT ribosomal protein L17 (BL15) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12682299, 6801428; Product type s: structure GB:PROTEIN_ID CAB11920.1 GB:DB_XREF GOA:P20277 HSSP:1GD8 InterPro:IPR000456 SubtiList:BG11041 UniProtKB/Swiss-Prot:P20277 GB:GENE:GENE rplQ LENGTH 120 SQ:AASEQ MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVEKMITLGKRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRIMKLGPRRGDGAPMAIIELV GT:EXON 1|1-120:0| SW:ID RL17_BACSU SW:DE RecName: Full=50S ribosomal protein L17;AltName: Full=BL15;AltName: Full=BL21; SW:GN Name=rplQ; OrderedLocusNames=BSU01440; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->120|RL17_BACSU|5e-64|100.0|120/120| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 30->52|PS01167|RIBOSOMAL_L17|PDOC00897| BL:PDB:NREP 1 BL:PDB:REP 5->120|3bboP|1e-26|53.7|108/116| RP:PDB:NREP 1 RP:PDB:REP 2->120|3bboP|8e-43|52.3|111/116| RP:PFM:NREP 1 RP:PFM:REP 16->120|PF01196|2e-27|69.1|97/97|Ribosomal_L17| HM:PFM:NREP 1 HM:PFM:REP 16->120|PF01196|2.6e-43|59.8|97/97|Ribosomal_L17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01196|IPR000456| GO:PFM GO:0005622|"GO:intracellular"|PF01196|IPR000456| GO:PFM GO:0005840|"GO:ribosome"|PF01196|IPR000456| GO:PFM GO:0006412|"GO:translation"|PF01196|IPR000456| RP:SCP:NREP 1 RP:SCP:REP 10->120|1gd8A|2e-39|51.5|103/105|d.188.1.1| HM:SCP:REP 10->121|1gd8A_|1.8e-40|59.6|104/105|d.188.1.1|1/1|Prokaryotic ribosomal protein L17| OP:NHOMO 1107 OP:NHOMOORG 1049 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111112111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111--1111 -1--111------11111-111111111111-1111111111111111111111-1111111---111--11-11111111----111-1111111----121112--51-11111-2-1-11-11111151-111-11-1111111-1-11-111111--------------112222I2112243441322221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 98.3 SQ:SECSTR #ccccTTccGGGHHHHHHHHHHHHHHTccEEEcHHHHHHHHHHHHHHHHHHHHcTTHHHHHHHTTccc#HTTTcccTTHHHHHTTccGGGGcccccccEEccccccccccccccEEEEEc DISOP:02AL 3-11| PSIPRED cccccccccHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEEEc //