[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rplW
DDBJ      :rplW         ribosomal protein L23
Swiss-Prot:RL23_BACSU   RecName: Full=50S ribosomal protein L23;

Homologs  Archaea  4/68 : Bacteria  528/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.12.1
:95 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->91 2zjrQ PDBj 4e-18 47.1 %
:RPS:PDB   3->93 3bboV PDBj 2e-16 34.6 %
:RPS:SCOP  2->88 1vs6T1  d.12.1.1 * 6e-18 33.3 %
:HMM:SCOP  1->96 1n88A_ d.12.1.1 * 3.9e-28 47.3 %
:RPS:PFM   6->83 PF00276 * Ribosomal_L23 8e-15 57.7 %
:HMM:PFM   6->91 PF00276 * Ribosomal_L23 1.8e-33 51.2 86/92  
:BLT:SWISS 1->95 RL23_BACSU 9e-50 100.0 %
:PROS 77->92|PS00050|RIBOSOMAL_L23

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11894.2 GT:GENE rplW GT:PRODUCT ribosomal protein L23 GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 136992..137279 GB:FROM 136992 GB:TO 137279 GB:DIRECTION + GB:GENE rplW GB:PRODUCT ribosomal protein L23 GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12682299, 6417453; Product type s: structure GB:PROTEIN_ID CAB11894.2 GB:DB_XREF GOA:P42924 InterPro:IPR012677 SubtiList:BG11221 UniProtKB/Swiss-Prot:P42924 GB:GENE:GENE rplW LENGTH 95 SQ:AASEQ MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA GT:EXON 1|1-95:0| SW:ID RL23_BACSU SW:DE RecName: Full=50S ribosomal protein L23; SW:GN Name=rplW; OrderedLocusNames=BSU01180; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|RL23_BACSU|9e-50|100.0|95/95| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 77->92|PS00050|RIBOSOMAL_L23|PDOC00049| BL:PDB:NREP 1 BL:PDB:REP 6->91|2zjrQ|4e-18|47.1|85/93| RP:PDB:NREP 1 RP:PDB:REP 3->93|3bboV|2e-16|34.6|78/85| RP:PFM:NREP 1 RP:PFM:REP 6->83|PF00276|8e-15|57.7|78/91|Ribosomal_L23| HM:PFM:NREP 1 HM:PFM:REP 6->91|PF00276|1.8e-33|51.2|86/92|Ribosomal_L23| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00276|IPR013025| GO:PFM GO:0005622|"GO:intracellular"|PF00276|IPR013025| GO:PFM GO:0005840|"GO:ribosome"|PF00276|IPR013025| GO:PFM GO:0006412|"GO:translation"|PF00276|IPR013025| RP:SCP:NREP 1 RP:SCP:REP 2->88|1vs6T1|6e-18|33.3|87/99|d.12.1.1| HM:SCP:REP 1->96|1n88A_|3.9e-28|47.3|93/96|d.12.1.1|1/1|Ribosomal proteins S24e, L23 and L15e| OP:NHOMO 536 OP:NHOMOORG 533 OP:PATTERN ------------------------------------------------------111---1------- 1111111111111111111-11111111111111111111111111111111111111111-11-11111111111111111111--1--------1------1---111-------------------1---1--111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1111111111111111111111-11111----211111-111---1111111111111111---1--1-1111-11111111111111111111----1-111111111111-11-1------------------------1---1--1--------111111111111111111111111111111111-1----------------11-------11----111-1-1---1---1111-11111111111-1-------------------------11--------------------------------11---------------------------------------------------------------------------------------------------------1--1----------------1111111111--111111111111111111111111111------------------------------1---------------11111111-11111--11111--11---1-1--111111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 98.9 SQ:SECSTR ccccccccccccccHHHHHHHHTcEEccEEcTTccHHHHHHTTTTTccccEEEcccEEETTTEEccccccccccccEEccEEEcTTTcTTTHHT# PSIPRED cccHHHHHccccccHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccEEEEEEEEEccccEEEccccccccccEEEEEEEEcccccEEccccc //