[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rplX
DDBJ      :rplX         ribosomal protein L24 (BL23)
Swiss-Prot:RL24_BACSU   RecName: Full=50S ribosomal protein L24;AltName: Full=BL23;AltName: Full=12 kDa DNA-binding protein;AltName: Full=HPB12;

Homologs  Archaea  0/68 : Bacteria  889/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->101 1vorV PDBj 2e-27 50.5 %
:RPS:PDB   1->103 3bboW PDBj 3e-28 41.7 %
:RPS:SCOP  1->101 1vs6U1  b.34.5.1 * 1e-25 46.0 %
:HMM:SCOP  2->100 2gyaS1 b.34.5.1 * 7.5e-37 65.3 %
:HMM:PFM   5->36 PF00467 * KOW 6.5e-13 50.0 32/32  
:BLT:SWISS 1->103 RL24_BACSU 3e-56 100.0 %
:PROS 6->23|PS01108|RIBOSOMAL_L24

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11903.1 GT:GENE rplX GT:PRODUCT ribosomal protein L24 (BL23) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 140857..141168 GB:FROM 140857 GB:TO 141168 GB:DIRECTION + GB:GENE rplX GB:PRODUCT ribosomal protein L24 (BL23) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11278078, 12682299; Product type s: structure GB:PROTEIN_ID CAB11903.1 GB:DB_XREF GOA:P12876 InterPro:IPR014723 SubtiList:BG10759 UniProtKB/Swiss-Prot:P12876 GB:GENE:GENE rplX LENGTH 103 SQ:AASEQ MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK GT:EXON 1|1-103:0| SW:ID RL24_BACSU SW:DE RecName: Full=50S ribosomal protein L24;AltName: Full=BL23;AltName: Full=12 kDa DNA-binding protein;AltName: Full=HPB12; SW:GN Name=rplX; OrderedLocusNames=BSU01270; SW:KW Complete proteome; Cytoplasm; Direct protein sequencing; DNA-binding;Ribonucleoprotein; Ribosomal protein; RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->103|RL24_BACSU|3e-56|100.0|103/103| GO:SWS:NREP 6 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 6->23|PS01108|RIBOSOMAL_L24|PDOC00852| BL:PDB:NREP 1 BL:PDB:REP 1->101|1vorV|2e-27|50.5|101/113| RP:PDB:NREP 1 RP:PDB:REP 1->103|3bboW|3e-28|41.7|103/110| HM:PFM:NREP 1 HM:PFM:REP 5->36|PF00467|6.5e-13|50.0|32/32|KOW| RP:SCP:NREP 1 RP:SCP:REP 1->101|1vs6U1|1e-25|46.0|100/102|b.34.5.1| HM:SCP:REP 2->100|2gyaS1|7.5e-37|65.3|98/0|b.34.5.1|1/1|Translation proteins SH3-like domain| OP:NHOMO 998 OP:NHOMOORG 950 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111---1111111111--111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111121111111111111111111111111111-11111111111111111111111111111111111111111111111111111111-111111--1111-11111111111111-11111111111111111111111111111111111111111111-111111111111111111--11111111111-11111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 21--11--1---111----------------------------------------------------------------------------------------112-131211111-11---11-----------11----1-11-1---1-----111----1---111---112222P122113332-3211-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 100.0 SQ:SECSTR ccccccccEEEcccccTTccccccccccccccccccccccccccccccccccccccccccccccGGGEEEccccccccccccccccccccccccccccccccc DISOP:02AL 46-56, 102-103| PSIPRED cEEEEccEEEEEEccccccEEEEEEEEccccEEEEEcccEEEEEEccccccccccEEEEEcccccccEEEEEcccccccEEEEEEEcccEEEEEEcccccccc //