[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpmC
DDBJ      :rpmC         ribosomal protein L29
Swiss-Prot:RL29_BACSU   RecName: Full=50S ribosomal protein L29;

Homologs  Archaea  0/68 : Bacteria  332/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.2
:66 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->56 1yl3W PDBj 2e-11 53.6 %
:RPS:PDB   1->62 3bboZ PDBj 5e-13 41.9 %
:RPS:SCOP  1->63 1vs6X1  a.2.2.1 * 6e-15 39.7 %
:HMM:SCOP  1->66 1r73A_ a.2.2.1 * 4.5e-21 57.6 %
:RPS:PFM   5->60 PF00831 * Ribosomal_L29 8e-08 66.1 %
:HMM:PFM   3->60 PF00831 * Ribosomal_L29 1.7e-29 60.3 58/58  
:BLT:SWISS 1->66 RL29_BACSU 1e-31 100.0 %
:PROS 39->53|PS00579|RIBOSOMAL_L29

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11900.1 GT:GENE rpmC GT:PRODUCT ribosomal protein L29 GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 139924..140124 GB:FROM 139924 GB:TO 140124 GB:DIRECTION + GB:GENE rpmC GB:PRODUCT ribosomal protein L29 GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB11900.1 GB:DB_XREF GOA:P12873 InterPro:IPR018254 SubtiList:BG10756 UniProtKB/Swiss-Prot:P12873 GB:GENE:GENE rpmC LENGTH 66 SQ:AASEQ MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAIARMKTVIREREIAANK GT:EXON 1|1-66:0| SW:ID RL29_BACSU SW:DE RecName: Full=50S ribosomal protein L29; SW:GN Name=rpmC; OrderedLocusNames=BSU01240; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|RL29_BACSU|1e-31|100.0|66/66| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 39->53|PS00579|RIBOSOMAL_L29|PDOC00501| BL:PDB:NREP 1 BL:PDB:REP 1->56|1yl3W|2e-11|53.6|56/64| RP:PDB:NREP 1 RP:PDB:REP 1->62|3bboZ|5e-13|41.9|62/65| RP:PFM:NREP 1 RP:PFM:REP 5->60|PF00831|8e-08|66.1|56/58|Ribosomal_L29| HM:PFM:NREP 1 HM:PFM:REP 3->60|PF00831|1.7e-29|60.3|58/58|Ribosomal_L29| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00831|IPR001854| GO:PFM GO:0005622|"GO:intracellular"|PF00831|IPR001854| GO:PFM GO:0005840|"GO:ribosome"|PF00831|IPR001854| GO:PFM GO:0006412|"GO:translation"|PF00831|IPR001854| RP:SCP:NREP 1 RP:SCP:REP 1->63|1vs6X1|6e-15|39.7|63/63|a.2.2.1| HM:SCP:REP 1->66|1r73A_|4.5e-21|57.6|66/0|a.2.2.1|1/1|Ribosomal protein L29 (L29p)| OP:NHOMO 333 OP:NHOMOORG 332 OP:PATTERN -------------------------------------------------------------------- 111--111111-1111111-1111-111111-1111-111111-11-1---11111-111---1-11111-11111111111------------------------------------------------------11111------1---------11--1----------1-----1---------11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------1--11111111111-------------1---------111111111111111111111111---11111111111111111111-1----111121111-11111111111-11111111111-11111111111-111111-111-111111111----111--------111-11-1------------------------------11111----1--------------------------------1----------------------------------111-11--1111--1-1111-11-------1------------------------------1-----1-1-----------------------------------------------------------------------11----------------------------------------------------------------1-----------------------------------------------1----------1-------------------1-----------------1-1-1--------------------------1-1-1--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHccHHHHHHHHHHHTTHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHTc DISOP:02AL 32-43, 62-66| PSIPRED ccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccc //