[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpmD
DDBJ      :rpmD         ribosomal protein L30 (BL27)
Swiss-Prot:RL30_BACSU   RecName: Full=50S ribosomal protein L30;AltName: Full=BL27;

Homologs  Archaea  0/68 : Bacteria  264/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.59.1
:59 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->58 2zjrW PDBj 2e-09 47.3 %
:RPS:PDB   1->58 1bxyA PDBj 5e-17 44.8 %
:RPS:SCOP  1->58 1bxyA  d.59.1.1 * 2e-17 44.8 %
:HMM:SCOP  1->60 1bxyA_ d.59.1.1 * 6.9e-19 58.3 %
:RPS:PFM   4->54 PF00327 * Ribosomal_L30 2e-09 56.9 %
:HMM:PFM   4->54 PF00327 * Ribosomal_L30 1e-24 45.1 51/52  
:BLT:SWISS 1->59 RL30_BACSU 1e-28 100.0 %
:PROS 22->54|PS00634|RIBOSOMAL_L30

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11910.1 GT:GENE rpmD GT:PRODUCT ribosomal protein L30 (BL27) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 143875..144054 GB:FROM 143875 GB:TO 144054 GB:DIRECTION + GB:GENE rpmD GB:PRODUCT ribosomal protein L30 (BL27) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB11910.1 GB:DB_XREF GOA:P19947 HSSP:1BXY InterPro:IPR000517 SubtiList:BG10443 UniProtKB/Swiss-Prot:P19947 GB:GENE:GENE rpmD LENGTH 59 SQ:AASEQ MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVSHLVSVKEQ GT:EXON 1|1-59:0| SW:ID RL30_BACSU SW:DE RecName: Full=50S ribosomal protein L30;AltName: Full=BL27; SW:GN Name=rpmD; OrderedLocusNames=BSU01340; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->59|RL30_BACSU|1e-28|100.0|59/59| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 22->54|PS00634|RIBOSOMAL_L30|PDOC00551| BL:PDB:NREP 1 BL:PDB:REP 4->58|2zjrW|2e-09|47.3|55/55| RP:PDB:NREP 1 RP:PDB:REP 1->58|1bxyA|5e-17|44.8|58/60| RP:PFM:NREP 1 RP:PFM:REP 4->54|PF00327|2e-09|56.9|51/52|Ribosomal_L30| HM:PFM:NREP 1 HM:PFM:REP 4->54|PF00327|1e-24|45.1|51/52|Ribosomal_L30| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00327|IPR000517| GO:PFM GO:0005622|"GO:intracellular"|PF00327|IPR000517| GO:PFM GO:0005840|"GO:ribosome"|PF00327|IPR000517| GO:PFM GO:0006412|"GO:translation"|PF00327|IPR000517| RP:SCP:NREP 1 RP:SCP:REP 1->58|1bxyA|2e-17|44.8|58/60|d.59.1.1| HM:SCP:REP 1->60|1bxyA_|6.9e-19|58.3|60/60|d.59.1.1|1/1|Ribosomal protein L30p/L7e| OP:NHOMO 264 OP:NHOMOORG 264 OP:PATTERN -------------------------------------------------------------------- ----1------1-11--11-11---111111-111111111111111-111-11------11--111111--111111--1-1----------111---11111---1---------------------1------1111111111-------------------------------------11-------11111111111111111111111111111111111111111111111111111111111111--11111-1---111111---111111111111111111111111111111111111111111111111--11-111111111111111111--11-1--111-1111-111-------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-1111------------1-----------------1--11--------------------1------1---------------------------------------------------------------1---------------------------------------------------------------------------------------------------111----------------------------------------------------------------1111111-11----------------1---------------1----------------------------1-11111-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 98.3 SQ:SECSTR ccEEEEEEccccTTccHHHHHHHHHHTcccTTcEEEEEccHHHHHHHHHTTTTEEEEE# DISOP:02AL 59-60| PSIPRED ccEEEEEEEEccccccHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHEEEEEc //