[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpmH
DDBJ      :rpmH         ribosomal protein L34
Swiss-Prot:RL34_BACSU   RecName: Full=50S ribosomal protein L34;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->26 1yl37 PDBj 2e-08 73.1 %
:HMM:PFM   1->44 PF00468 * Ribosomal_L34 8e-26 65.9 44/44  
:BLT:SWISS 1->26 RL34_BACSU 3e-11 100.0 %
:PROS 2->21|PS00784|RIBOSOMAL_L34
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16143.1 GT:GENE rpmH GT:PRODUCT ribosomal protein L34 GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4215255..4215389) GB:FROM 4215255 GB:TO 4215389 GB:DIRECTION - GB:GENE rpmH GB:PRODUCT ribosomal protein L34 GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299, 7539334, 9371771; Product type s : structure GB:PROTEIN_ID CAB16143.1 GB:DB_XREF GOA:P05647 InterPro:IPR000271 SubtiList:BG10064 UniProtKB/Swiss-Prot:P05647 GB:GENE:GENE rpmH LENGTH 44 SQ:AASEQ MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA GT:EXON 1|1-44:0| SW:ID RL34_BACSU SW:DE RecName: Full=50S ribosomal protein L34; SW:GN Name=rpmH; OrderedLocusNames=BSU41060; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->26|RL34_BACSU|3e-11|100.0|26/44| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 2->21|PS00784|RIBOSOMAL_L34|PDOC00626| SEG 27->41|grlvlarrrrkgrkv| BL:PDB:NREP 1 BL:PDB:REP 1->26|1yl37|2e-08|73.1|26/46| HM:PFM:NREP 1 HM:PFM:REP 1->44|PF00468|8e-26|65.9|44/44|Ribosomal_L34| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 40-44| PSIPRED ccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccc //