[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpmI
DDBJ      :rpmI         ribosomal protein L35
Swiss-Prot:RL35_BACSU   RecName: Full=50S ribosomal protein L35;

Homologs  Archaea  0/68 : Bacteria  156/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.301.1
:66 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->34 3bbo5 PDBj 2e-06 59.4 %
:RPS:PDB   3->62 3bbo5 PDBj 3e-08 36.7 %
:RPS:SCOP  2->62 1vs631  d.301.1.1 * 1e-09 41.0 %
:HMM:SCOP  2->65 2i2t31 d.301.1.1 * 2.2e-22 53.1 %
:RPS:PFM   2->62 PF01632 * Ribosomal_L35p 4e-04 49.2 %
:HMM:PFM   2->62 PF01632 * Ribosomal_L35p 5.7e-28 55.7 61/61  
:BLT:SWISS 1->66 RL35_BACSU 9e-26 100.0 %
:PROS 5->31|PS00936|RIBOSOMAL_L35
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14846.1 GT:GENE rpmI GT:PRODUCT ribosomal protein L35 GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2952615..2952815) GB:FROM 2952615 GB:TO 2952815 GB:DIRECTION - GB:GENE rpmI GB:PRODUCT ribosomal protein L35 GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299, 17289755, 8722036; Product type s : structure GB:PROTEIN_ID CAB14846.1 GB:DB_XREF GOA:P55874 InterPro:IPR018265 SubtiList:BG11972 UniProtKB/Swiss-Prot:P55874 GB:GENE:GENE rpmI LENGTH 66 SQ:AASEQ MPKMKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSAVVSAGDFKRIKQMLANIK GT:EXON 1|1-66:0| SW:ID RL35_BACSU SW:DE RecName: Full=50S ribosomal protein L35; SW:GN Name=rpmI; OrderedLocusNames=BSU28860; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|RL35_BACSU|9e-26|100.0|66/66| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 5->31|PS00936|RIBOSOMAL_L35|PDOC00721| SEG 36->47|ksqkqkrklrks| BL:PDB:NREP 1 BL:PDB:REP 3->34|3bbo5|2e-06|59.4|32/62| RP:PDB:NREP 1 RP:PDB:REP 3->62|3bbo5|3e-08|36.7|60/62| RP:PFM:NREP 1 RP:PFM:REP 2->62|PF01632|4e-04|49.2|61/61|Ribosomal_L35p| HM:PFM:NREP 1 HM:PFM:REP 2->62|PF01632|5.7e-28|55.7|61/61|Ribosomal_L35p| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01632|IPR001706| GO:PFM GO:0005622|"GO:intracellular"|PF01632|IPR001706| GO:PFM GO:0005840|"GO:ribosome"|PF01632|IPR001706| GO:PFM GO:0006412|"GO:translation"|PF01632|IPR001706| RP:SCP:NREP 1 RP:SCP:REP 2->62|1vs631|1e-09|41.0|61/64|d.301.1.1| HM:SCP:REP 2->65|2i2t31|2.2e-22|53.1|64/0|d.301.1.1|1/1|L35p-like| OP:NHOMO 156 OP:NHOMOORG 156 OP:PATTERN -------------------------------------------------------------------- 11----------------------------------------------------------------------------1--------------1--------1-----------------------------------------------------------------------------------------1111111111111111111111111111111111111111111111111111111-11111-1-1111-111----111111--11111111111111111111111111111111111111111111111-11---------1-1----1111----1---1-111-11---111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------11111111-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 93.9 SQ:SECSTR cccccccHHHHTTcccccccccEEEccccTTcccccccccTTcccEEEcccTHHHHTTTTTT#### DISOP:02AL 1-8, 33-48| PSIPRED ccccccccccccEEEEcccccEEEcccccccccccccHHHHHccccccEEcHHHHHHHHHHHHHcc //