[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpsF
DDBJ      :rpsF         ribosomal protein S6 (BS9)
Swiss-Prot:RS6_BACSU    RecName: Full=30S ribosomal protein S6;AltName: Full=BS9;

Homologs  Archaea  0/68 : Bacteria  736/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.14
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->92 1vs5F PDBj 3e-13 30.8 %
:RPS:PDB   1->95 1cqmA PDBj 3e-30 31.6 %
:RPS:SCOP  1->95 1cqmA  d.58.14.1 * 3e-30 31.6 %
:HMM:SCOP  1->95 1cqmA_ d.58.14.1 * 8.1e-32 42.1 %
:RPS:PFM   4->92 PF01250 * Ribosomal_S6 1e-19 42.7 %
:HMM:PFM   2->92 PF01250 * Ribosomal_S6 7e-37 41.8 91/92  
:BLT:SWISS 1->95 RS6_BACSU 4e-51 100.0 %
:PROS 44->53|PS01048|RIBOSOMAL_S6

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16128.1 GT:GENE rpsF GT:PRODUCT ribosomal protein S6 (BS9) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4199445..4199732) GB:FROM 4199445 GB:TO 4199732 GB:DIRECTION - GB:GENE rpsF GB:PRODUCT ribosomal protein S6 (BS9) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299, 14762004; Product type f: factor GB:PROTEIN_ID CAB16128.1 GB:DB_XREF GOA:P21468 HSSP:1RIS InterPro:IPR014717 SubtiList:BG10049 UniProtKB/Swiss-Prot:P21468 GB:GENE:GENE rpsF LENGTH 95 SQ:AASEQ MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFYQIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEEE GT:EXON 1|1-95:0| SW:ID RS6_BACSU SW:DE RecName: Full=30S ribosomal protein S6;AltName: Full=BS9; SW:GN Name=rpsF; OrderedLocusNames=BSU40910; SW:KW Complete proteome; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|RS6_BACSU|4e-51|100.0|95/95| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 44->53|PS01048|RIBOSOMAL_S6|PDOC00805| BL:PDB:NREP 1 BL:PDB:REP 1->92|1vs5F|3e-13|30.8|91/100| RP:PDB:NREP 1 RP:PDB:REP 1->95|1cqmA|3e-30|31.6|95/98| RP:PFM:NREP 1 RP:PFM:REP 4->92|PF01250|1e-19|42.7|89/92|Ribosomal_S6| HM:PFM:NREP 1 HM:PFM:REP 2->92|PF01250|7e-37|41.8|91/92|Ribosomal_S6| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01250|IPR000529| GO:PFM GO:0005840|"GO:ribosome"|PF01250|IPR000529| GO:PFM GO:0006412|"GO:translation"|PF01250|IPR000529| GO:PFM GO:0019843|"GO:rRNA binding"|PF01250|IPR000529| RP:SCP:NREP 1 RP:SCP:REP 1->95|1cqmA|3e-30|31.6|95/98|d.58.14.1| HM:SCP:REP 1->95|1cqmA_|8.1e-32|42.1|95/0|d.58.14.1|1/1|Ribosomal protein S6| OP:NHOMO 740 OP:NHOMOORG 739 OP:PATTERN -------------------------------------------------------------------- 1111111----11-11111-111111111111111111111-1111111111111111--111111111111111111111111-1111111-111---111111-1111--------------1---------1-1-1-1111111111111--1111111111111111111111111111-----111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111-11---111111111111111111-11-11111111111-11111111111112-111111111111111111111111------------1111---11111------11--------------11---11111111111111111111111111111111111111111111111111111111111-11111111111-111-1--111----1111--111------11111111111111111111111111-111111111111111111111111111111111-1111111----1111111111111-111-1111111111111111111111111111111111111111111111111111-111111111111-111111111111-111111111111111111111-111-11111111111111111111111--------111111111111111111111111111111-------------------111111---1--------1----111-------1-1--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEcTTccHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEcHHHHHHHHHHHHTcTTEEEEEEEEccc DISOP:02AL 94-95| PSIPRED cccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHccccEEEEEEEEEccHHHHHHHHHHHccccccEEEEEEEEcc //