[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpsJ
DDBJ      :rpsJ         ribosomal protein S10 (BS13)
Swiss-Prot:RS10_BACSU   RecName: Full=30S ribosomal protein S10;AltName: Full=BS13;

Homologs  Archaea  55/68 : Bacteria  901/915 : Eukaryota  37/199 : Viruses  0/175   --->[See Alignment]
d.58.15
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->102 1vs5J PDBj 1e-34 64.3 %
:RPS:PDB   4->102 3bbnJ PDBj 8e-35 50.5 %
:RPS:SCOP  5->101 1fjgJ  d.58.15.1 * 7e-34 62.9 %
:HMM:SCOP  5->102 1fjgJ_ d.58.15.1 * 3.3e-36 60.2 %
:RPS:PFM   6->102 PF00338 * Ribosomal_S10 1e-32 76.3 %
:HMM:PFM   6->102 PF00338 * Ribosomal_S10 6.7e-43 58.8 97/97  
:BLT:SWISS 1->102 RS10_BACSU 4e-54 100.0 %
:PROS 29->44|PS00361|RIBOSOMAL_S10

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11891.1 GT:GENE rpsJ GT:PRODUCT ribosomal protein S10 (BS13) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 135364..135672 GB:FROM 135364 GB:TO 135672 GB:DIRECTION + GB:GENE rpsJ GB:PRODUCT ribosomal protein S10 (BS13) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB11891.1 GB:DB_XREF GOA:P21471 HSSP:1J5E InterPro:IPR018268 SubtiList:BG19008 UniProtKB/Swiss-Prot:P21471 GB:GENE:GENE rpsJ LENGTH 102 SQ:AASEQ MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL GT:EXON 1|1-102:0| SW:ID RS10_BACSU SW:DE RecName: Full=30S ribosomal protein S10;AltName: Full=BS13; SW:GN Name=rpsJ; Synonyms=tetA; OrderedLocusNames=BSU01150; SW:KW Complete proteome; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->102|RS10_BACSU|4e-54|100.0|102/102| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 29->44|PS00361|RIBOSOMAL_S10|PDOC00312| BL:PDB:NREP 1 BL:PDB:REP 5->102|1vs5J|1e-34|64.3|98/98| RP:PDB:NREP 1 RP:PDB:REP 4->102|3bbnJ|8e-35|50.5|99/99| RP:PFM:NREP 1 RP:PFM:REP 6->102|PF00338|1e-32|76.3|97/97|Ribosomal_S10| HM:PFM:NREP 1 HM:PFM:REP 6->102|PF00338|6.7e-43|58.8|97/97|Ribosomal_S10| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00338|IPR001848| GO:PFM GO:0005622|"GO:intracellular"|PF00338|IPR001848| GO:PFM GO:0005840|"GO:ribosome"|PF00338|IPR001848| GO:PFM GO:0006412|"GO:translation"|PF00338|IPR001848| RP:SCP:NREP 1 RP:SCP:REP 5->101|1fjgJ|7e-34|62.9|97/98|d.58.15.1| HM:SCP:REP 5->102|1fjgJ_|3.3e-36|60.2|98/0|d.58.15.1|1/1|Ribosomal protein S10| OP:NHOMO 1013 OP:NHOMOORG 993 OP:PATTERN 1111-11111111111-11-1-111111-111111111111111111-1----111111111111--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111-111111111111-2-111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111-111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ----111--------1----------------------------------------------1--1-11-1----111111-----------------------12------2--------------------------------------------1------------3---211117111113123-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEEEccHHHHHHHTTHHHHTTTTTcccEEEEEEcccEEEEEcccccccccccccccEEEEEEEEEEEEccccHHHHHHHTTcccccccEEEEEc DISOP:02AL 1-2| PSIPRED cccEEEEEEEEEEcHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEccccccccccEEEEEEEEEEEEEEEcccHHHHHHHHccccccccEEEEEc //