[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpsL
DDBJ      :rpsL         ribosomal protein S12 (BS12)
Swiss-Prot:RS12_BACSU   RecName: Full=30S ribosomal protein S12;         Short=BS12;

Homologs  Archaea  6/68 : Bacteria  904/915 : Eukaryota  161/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:138 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->136 3bbnL PDBj 9e-49 76.4 %
:RPS:PDB   1->136 3bbnL PDBj 5e-50 76.4 %
:RPS:SCOP  2->138 1fjgL  b.40.4.5 * 2e-50 75.0 %
:HMM:SCOP  2->139 1fjgL_ b.40.4.5 * 1.7e-50 68.0 %
:RPS:PFM   3->136 PF00164 * Ribosomal_S12 3e-42 83.5 %
:HMM:PFM   2->136 PF00164 * Ribosomal_S12 2.1e-52 65.6 122/122  
:BLT:SWISS 1->138 RS12_BACSU 1e-77 100.0 %
:PROS 56->63|PS00055|RIBOSOMAL_S12

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11886.2 GT:GENE rpsL GT:PRODUCT ribosomal protein S12 (BS12) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 129702..130118 GB:FROM 129702 GB:TO 130118 GB:DIRECTION + GB:GENE rpsL GB:PRODUCT ribosomal protein S12 (BS12) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11489846, 12682299, 16484214; Product type s: structure GB:PROTEIN_ID CAB11886.2 GB:DB_XREF GOA:P21472 HSSP:1J5E InterPro:IPR005679 SubtiList:BG19009 UniProtKB/Swiss-Prot:P21472 GB:GENE:GENE rpsL LENGTH 138 SQ:AASEQ MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRAQGRSKYGTKKPKAK GT:EXON 1|1-138:0| SW:ID RS12_BACSU SW:DE RecName: Full=30S ribosomal protein S12; Short=BS12; SW:GN Name=rpsL; Synonyms=fun, strA; OrderedLocusNames=BSU01100; SW:KW Antibiotic resistance; Complete proteome; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein; RNA-binding; rRNA-binding;tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->138|RS12_BACSU|1e-77|100.0|138/138| GO:SWS:NREP 6 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 56->63|PS00055|RIBOSOMAL_S12|PDOC00054| BL:PDB:NREP 1 BL:PDB:REP 1->136|3bbnL|9e-49|76.4|123/123| RP:PDB:NREP 1 RP:PDB:REP 1->136|3bbnL|5e-50|76.4|123/123| RP:PFM:NREP 1 RP:PFM:REP 3->136|PF00164|3e-42|83.5|121/122|Ribosomal_S12| HM:PFM:NREP 1 HM:PFM:REP 2->136|PF00164|2.1e-52|65.6|122/122|Ribosomal_S12| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00164|IPR006032| GO:PFM GO:0005622|"GO:intracellular"|PF00164|IPR006032| GO:PFM GO:0005840|"GO:ribosome"|PF00164|IPR006032| GO:PFM GO:0006412|"GO:translation"|PF00164|IPR006032| RP:SCP:NREP 1 RP:SCP:REP 2->138|1fjgL|2e-50|75.0|124/125|b.40.4.5| HM:SCP:REP 2->139|1fjgL_|1.7e-50|68.0|125/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1099 OP:NHOMOORG 1071 OP:PATTERN -----------------------------------------------------1--11111------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111112-11111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111211111111111111111111111111111111111111111111111111111111111111111111111--111111111111111-11-111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------1---11111111111111111111111111-111111111111111111111-111111111111111111111111121-11111111111111111-1--21211--1111-1111121323-111111111111-11-1111111111211111111-111121211--------3-8112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 97.1 SQ:SECSTR cccTTHHHHTcccccccccccccTTT###cccccccTTTcccEEEEEEEEEEEcccccccccEEEEEEEETTccEEEEEcccccccccTTcEEEEccccccccTTccEEccTTcTTccccTTcccccccTTcccccc# PSIPRED cccHHHHHHccccccccccccHHccccccHHHccccccccccccEEEEEEEEEcccccccccccEEEEEEccccEEEEEccccccccccccEEEEEcccccccccccEEEEEEEEEcccccccccccccccccccccc //