[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpsM
DDBJ      :rpsM         ribosomal protein S13
Swiss-Prot:RS13_BACSU   RecName: Full=30S ribosomal protein S13;AltName: Full=BS14;

Homologs  Archaea  10/68 : Bacteria  907/915 : Eukaryota  86/199 : Viruses  0/175   --->[See Alignment]
a.156.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->121 2uuaM PDBj 3e-41 61.7 %
:RPS:PDB   2->117 3d5aM PDBj 1e-27 61.2 %
:RPS:SCOP  2->121 1fjgM  a.156.1.1 * 3e-27 61.7 %
:HMM:SCOP  2->120 1fjgM_ a.156.1.1 * 3.4e-43 60.5 %
:RPS:PFM   3->108 PF00416 * Ribosomal_S13 4e-26 69.8 %
:HMM:PFM   3->108 PF00416 * Ribosomal_S13 9.4e-43 50.9 106/106  
:BLT:SWISS 1->121 RS13_BACSU 1e-64 100.0 %
:PROS 87->100|PS00646|RIBOSOMAL_S13_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11917.2 GT:GENE rpsM GT:PRODUCT ribosomal protein S13 GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 147973..148338 GB:FROM 147973 GB:TO 148338 GB:DIRECTION + GB:GENE rpsM GB:PRODUCT ribosomal protein S13 GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB11917.2 GB:DB_XREF GOA:P20282 InterPro:IPR018269 SubtiList:BG10730 UniProtKB/Swiss-Prot:P20282 GB:GENE:GENE rpsM LENGTH 121 SQ:AASEQ MARIAGVDIPRDKRVVISLTYIFGIGRTTAQQVLKEAGVSEDTRVRDLTEEELGKIRDIIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNSKNNARTRKGPRRTVANKKK GT:EXON 1|1-121:0| SW:ID RS13_BACSU SW:DE RecName: Full=30S ribosomal protein S13;AltName: Full=BS14; SW:GN Name=rpsM; OrderedLocusNames=BSU01410; SW:KW Complete proteome; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->121|RS13_BACSU|1e-64|100.0|121/121| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 87->100|PS00646|RIBOSOMAL_S13_1|PDOC00556| BL:PDB:NREP 1 BL:PDB:REP 2->121|2uuaM|3e-41|61.7|120/125| RP:PDB:NREP 1 RP:PDB:REP 2->117|3d5aM|1e-27|61.2|116/117| RP:PFM:NREP 1 RP:PFM:REP 3->108|PF00416|4e-26|69.8|106/107|Ribosomal_S13| HM:PFM:NREP 1 HM:PFM:REP 3->108|PF00416|9.4e-43|50.9|106/106|Ribosomal_S13| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00416|IPR001892| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00416|IPR001892| GO:PFM GO:0005622|"GO:intracellular"|PF00416|IPR001892| GO:PFM GO:0005840|"GO:ribosome"|PF00416|IPR001892| GO:PFM GO:0006412|"GO:translation"|PF00416|IPR001892| RP:SCP:NREP 1 RP:SCP:REP 2->121|1fjgM|3e-27|61.7|120/125|a.156.1.1| HM:SCP:REP 2->120|1fjgM_|3.4e-43|60.5|119/125|a.156.1.1|1/1|S13-like H2TH domain| OP:NHOMO 1041 OP:NHOMOORG 1003 OP:PATTERN 1---------------1-----------1-----111----------1--1-1-------1------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------1111122111--1----1---111-1111111-1--11111111-1111-1112221321-12-111112221111--1-11-1---1--11-1--2-------------------------------------------------1---------------11111E1111131-3222------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 100.0 SQ:SECSTR GccccTTcccccccHHHHHHHcTTccHHHHHHHHTTTTccccccGGGccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHTccHHHHHHHHTccccccccccccHHHHccccccccccc DISOP:02AL 120-122| PSIPRED ccEEEccccccccEEEEEEEEHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccccccccccccccccccccc //