[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpsQ
DDBJ      :rpsQ         ribosomal protein S17 (BS16)
Swiss-Prot:RS17_BACSU   RecName: Full=30S ribosomal protein S17;AltName: Full=BS16;

Homologs  Archaea  2/68 : Bacteria  885/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->85 1ripA PDBj 3e-38 88.8 %
:RPS:PDB   7->86 3d5aQ PDBj 6e-23 52.5 %
:RPS:SCOP  8->85 1vs5Q1  b.40.4.5 * 1e-24 56.4 %
:HMM:SCOP  6->84 1fjgQ_ b.40.4.5 * 1.8e-29 58.2 %
:RPS:PFM   12->80 PF00366 * Ribosomal_S17 2e-16 66.7 %
:HMM:PFM   12->80 PF00366 * Ribosomal_S17 1.5e-32 62.3 69/69  
:BLT:SWISS 1->87 RS17_BACSU 2e-45 100.0 %
:PROS 58->70|PS00056|RIBOSOMAL_S17

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11901.1 GT:GENE rpsQ GT:PRODUCT ribosomal protein S17 (BS16) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 140147..140410 GB:FROM 140147 GB:TO 140410 GB:DIRECTION + GB:GENE rpsQ GB:PRODUCT ribosomal protein S17 (BS16) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB11901.1 GB:DB_XREF GOA:P12874 HSSP:1RIP InterPro:IPR019979 SubtiList:BG10757 UniProtKB/Swiss-Prot:P12874 GB:GENE:GENE rpsQ LENGTH 87 SQ:AASEQ MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKKFKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII GT:EXON 1|1-87:0| SW:ID RS17_BACSU SW:DE RecName: Full=30S ribosomal protein S17;AltName: Full=BS16; SW:GN Name=rpsQ; OrderedLocusNames=BSU01250; SW:KW Complete proteome; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->87|RS17_BACSU|2e-45|100.0|87/87| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 58->70|PS00056|RIBOSOMAL_S17|PDOC00055| BL:PDB:NREP 1 BL:PDB:REP 6->85|1ripA|3e-38|88.8|80/81| RP:PDB:NREP 1 RP:PDB:REP 7->86|3d5aQ|6e-23|52.5|80/99| RP:PFM:NREP 1 RP:PFM:REP 12->80|PF00366|2e-16|66.7|69/69|Ribosomal_S17| HM:PFM:NREP 1 HM:PFM:REP 12->80|PF00366|1.5e-32|62.3|69/69|Ribosomal_S17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00366|IPR000266| GO:PFM GO:0005622|"GO:intracellular"|PF00366|IPR000266| GO:PFM GO:0005840|"GO:ribosome"|PF00366|IPR000266| GO:PFM GO:0006412|"GO:translation"|PF00366|IPR000266| RP:SCP:NREP 1 RP:SCP:REP 8->85|1vs5Q1|1e-24|56.4|78/80|b.40.4.5| HM:SCP:REP 6->84|1fjgQ_|1.8e-29|58.2|79/104|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 940 OP:NHOMOORG 912 OP:PATTERN ---------------------------------1--------------1------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111112-11-111111111111111111111111-11111111111112-1111111111-1-111111111111111111111111111---11111--111111111111111-1--11--1-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111-1111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-111111-1111111111111111111111111 ------------11-----------------------------------------------------------1---------------11--11----------1---------------------------------------------------------------------11--G122223112-21111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 93.1 SQ:SECSTR #####cccEEEEEEEEcccccEEEEEEEEEEEcTTTccEEEEEEEEEEEcTTccccTTcEEEEEEEEEEETTEEEEEEEEEEcccH# DISOP:02AL 1-5| PSIPRED ccccccEEEEEEEEEEcccccEEEEEEEEEEEccEEEEEEEEEccEEEEccccccccccEEEEEEccccccEEEEEEEEEEEEEEEc //