[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpsT
DDBJ      :rpsT         ribosomal protein S20 (BS20)
Swiss-Prot:RS20_BACSU   RecName: Full=30S ribosomal protein S20;         Short=BS20;

Homologs  Archaea  0/68 : Bacteria  488/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.7.6
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->87 1vs5T PDBj 2e-14 41.2 %
:RPS:PDB   6->82 3bbnT PDBj 4e-07 44.2 %
:RPS:SCOP  5->88 1fjgT  a.7.6.1 * 2e-16 39.3 %
:HMM:SCOP  3->86 1fjgT_ a.7.6.1 * 2.2e-24 50.0 %
:RPS:PFM   3->84 PF01649 * Ribosomal_S20p 2e-04 58.5 %
:HMM:PFM   2->84 PF01649 * Ribosomal_S20p 6.1e-33 54.2 83/84  
:BLT:SWISS 1->88 RS20_BACSU 1e-44 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14497.2 GT:GENE rpsT GT:PRODUCT ribosomal protein S20 (BS20) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2635815..2636081 GB:FROM 2635815 GB:TO 2636081 GB:DIRECTION + GB:GENE rpsT GB:PRODUCT ribosomal protein S20 (BS20) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299, 16629673; Product type s : structure GB:PROTEIN_ID CAB14497.2 GB:DB_XREF GOA:P21477 InterPro:IPR002583 SubtiList:BG11643 UniProtKB/Swiss-Prot:P21477 GB:GENE:GENE rpsT LENGTH 88 SQ:AASEQ MPNIKSAIKRTKTNNERRVHNATIKSAMRTAIKQVEASVANNEADKAKTALTEAAKRIDKAVKTGLVHKNTAARYKSRLAKKVNGLSA GT:EXON 1|1-88:0| SW:ID RS20_BACSU SW:DE RecName: Full=30S ribosomal protein S20; Short=BS20; SW:GN Name=rpsT; Synonyms=yqeO; OrderedLocusNames=BSU25550; SW:KW Complete proteome; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|RS20_BACSU|1e-44|100.0|88/88| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 3->87|1vs5T|2e-14|41.2|85/85| RP:PDB:NREP 1 RP:PDB:REP 6->82|3bbnT|4e-07|44.2|77/102| RP:PFM:NREP 1 RP:PFM:REP 3->84|PF01649|2e-04|58.5|82/84|Ribosomal_S20p| HM:PFM:NREP 1 HM:PFM:REP 2->84|PF01649|6.1e-33|54.2|83/84|Ribosomal_S20p| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF01649|IPR002583| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01649|IPR002583| GO:PFM GO:0005622|"GO:intracellular"|PF01649|IPR002583| GO:PFM GO:0005840|"GO:ribosome"|PF01649|IPR002583| GO:PFM GO:0006412|"GO:translation"|PF01649|IPR002583| RP:SCP:NREP 1 RP:SCP:REP 5->88|1fjgT|2e-16|39.3|84/99|a.7.6.1| HM:SCP:REP 3->86|1fjgT_|2.2e-24|50.0|84/99|a.7.6.1|1/1|Ribosomal protein S20| OP:NHOMO 491 OP:NHOMOORG 490 OP:PATTERN -------------------------------------------------------------------- ---111-11111-111111-11111-11111111111111-111-111111-1111111111111111111-------1------1-------1------------------------------------------111---------1----1111-111--1-111111-11----1-------11-1-111111111111111111111111111111-1111111111--111111111111111111111-1111----11--11-1-----11---11111--111111111111111111111111111---1111-11--1111111-1--1--11--1-111-1-1111111--111--1--11-11----------1---------------------------------1-1---------------1--1----11-11111111-11-1--1----------------------------------111111------11111----111111-------------1---1--1----1---1111111111111--1-1-111-11--11-----1-1-11------11---------------------1-1-11--1-111111111111111111111111111-11--11-------11-111111111-11-1111111111111111111-1111111-1111111111111111111--111-111111111111-111111111111111-1---11--111-111-1111111--1--1111--111----11111111111111---111111-1111----------111111-1----------------1-1------1--------1--1-----1-111-111--- ------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 96.6 SQ:SECSTR ##ccccccHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHTTccccccccTTHHHHHHHHHTTHHHTTc# DISOP:02AL 88-89| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc //