[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : rpsU
DDBJ      :rpsU         ribosomal protein S21
Swiss-Prot:RS21_BACSU   RecName: Full=30S ribosomal protein S21;AltName: Full=BS-B;

Homologs  Archaea  0/68 : Bacteria  148/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->42 1vs5U PDBj 1e-09 64.9 %
:RPS:PDB   5->43 3bbnU PDBj 2e-06 41.0 %
:HMM:PFM   5->57 PF01165 * Ribosomal_S21 2.2e-25 58.5 53/57  
:BLT:SWISS 1->43 RS21_BACSU 1e-19 100.0 %
:PROS 13->25|PS01181|RIBOSOMAL_S21
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14483.1 GT:GENE rpsU GT:PRODUCT ribosomal protein S21 GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2620371..2620544) GB:FROM 2620371 GB:TO 2620544 GB:DIRECTION - GB:GENE rpsU GB:PRODUCT ribosomal protein S21 GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299; Product type s: structure GB:PROTEIN_ID CAB14483.1 GB:DB_XREF GOA:P21478 InterPro:IPR018278 SubtiList:BG11648 UniProtKB/Swiss-Prot:P21478 GB:GENE:GENE rpsU LENGTH 57 SQ:AASEQ MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKRKF GT:EXON 1|1-57:0| SW:ID RS21_BACSU SW:DE RecName: Full=30S ribosomal protein S21;AltName: Full=BS-B; SW:GN Name=rpsU; Synonyms=yqeX; OrderedLocusNames=BSU25410; SW:KW Complete proteome; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->43|RS21_BACSU|1e-19|100.0|43/57| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 13->25|PS01181|RIBOSOMAL_S21|PDOC00909| SEG 44->56|krkkkseaarkrk| BL:PDB:NREP 1 BL:PDB:REP 6->42|1vs5U|1e-09|64.9|37/51| RP:PDB:NREP 1 RP:PDB:REP 5->43|3bbnU|2e-06|41.0|39/53| HM:PFM:NREP 1 HM:PFM:REP 5->57|PF01165|2.2e-25|58.5|53/57|Ribosomal_S21| OP:NHOMO 148 OP:NHOMOORG 148 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-11111111111111111111-1111111111-1-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-----------1---11111----111--11-1----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 71.9 SQ:SECSTR ##ccccccccccccccccccTTTTTTHHHHcccccccTTTTTT############## DISOP:02AL 1-2, 41-57| PSIPRED cccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHccc //