[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : safA
DDBJ      :safA         morphogenetic protein associated with SpoVID
Swiss-Prot:SAFA_BACSU   RecName: Full=SpoIVD-associated factor A;AltName: Full=Morphogenetic protein safA;

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.7.1
:387 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->45 1e01A PDBj 5e-04 43.2 %
:RPS:PDB   2->50 1e01A PDBj 9e-14 34.8 %
:RPS:SCOP  2->50 1e0gA  d.7.1.1 * 4e-14 34.8 %
:HMM:SCOP  1->50 1y7mA2 d.7.1.1 * 4.1e-11 45.8 %
:RPS:PFM   4->38 PF01476 * LysM 9e-06 51.4 %
:HMM:PFM   4->48 PF01476 * LysM 5.3e-17 43.2 44/44  
:HMM:PFM   132->157 PF07529 * HSA 0.00025 23.1 26/73  
:BLT:SWISS 1->387 SAFA_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14744.1 GT:GENE safA GT:PRODUCT morphogenetic protein associated with SpoVID GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2844675..2845838) GB:FROM 2844675 GB:TO 2845838 GB:DIRECTION - GB:GENE safA GB:PRODUCT morphogenetic protein associated with SpoVID GB:FUNCTION 16.8: Protect 16.13: Shape GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10438771, 10714986, 11040425, 15901704; Product type f: factor GB:PROTEIN_ID CAB14744.1 GB:DB_XREF GOA:O32062 InterPro:IPR014248 SubtiList:BG13781 UniProtKB/Swiss-Prot:O32062 GB:GENE:GENE safA LENGTH 387 SQ:AASEQ MKIHIVQKGDSLWKIAEKYGVDVEEVKKLNTQLSNPDLIMPGMKIKVPSEGVPVRKEPKAGKSPAAGSVKQEHPYAKEKPKSVVDVEDTKPKEKKSMPYVPPMPNLQENVYPEADVNDYYDMKQLFQPWSPPKPEEPKKHHDGNMDHMYHMQDQFPQQEAMSNMENANYPNMPNMPKAPEVGGIEEENVHHTVPNMPMPAVQPYYHYPAHFVPCPVPVSPILPGSGLCYPYYPAQAYPMHPMHGYQPGFVSPQYDPGYENQHHENSHHGHYGSYGAPQYASPAYGSPYGHMPYGPYYGTPQVMGAYQPAAAHGYMPYKDHDDCGCDGDHQPYFSAPGHSGMGAYGSPNMPYGTANPNPNPYSAGVSMPMTNQPSVNQMFGRPEEENE GT:EXON 1|1-387:0| SW:ID SAFA_BACSU SW:DE RecName: Full=SpoIVD-associated factor A;AltName: Full=Morphogenetic protein safA; SW:GN Name=safA; Synonyms=yrbA; OrderedLocusNames=BSU27840; SW:KW Complete proteome; Direct protein sequencing; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->387|SAFA_BACSU|0.0|100.0|387/387| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| SEG 131->139|ppkpeepkk| SEG 284->300|ygspyghmpygpyygtp| SEG 319->329|dhddcgcdgdh| BL:PDB:NREP 1 BL:PDB:REP 6->45|1e01A|5e-04|43.2|37/48| RP:PDB:NREP 1 RP:PDB:REP 2->50|1e01A|9e-14|34.8|46/48| RP:PFM:NREP 1 RP:PFM:REP 4->38|PF01476|9e-06|51.4|35/44|LysM| HM:PFM:NREP 2 HM:PFM:REP 4->48|PF01476|5.3e-17|43.2|44/44|LysM| HM:PFM:REP 132->157|PF07529|0.00025|23.1|26/73|HSA| GO:PFM:NREP 1 GO:PFM GO:0016998|"GO:cell wall macromolecule catabolic process"|PF01476|IPR018392| RP:SCP:NREP 1 RP:SCP:REP 2->50|1e0gA|4e-14|34.8|46/48|d.7.1.1| HM:SCP:REP 1->50|1y7mA2|4.1e-11|45.8|48/0|d.7.1.1|1/1|LysM domain| OP:NHOMO 31 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111-11---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 15.2 SQ:SECSTR #EEEEEcTTccHHHHHHHHTccHHHHHHHccTccccccccTTEEEEEccccccccccccc####################################################################################################################################################################################################################################################################################################################################### DISOP:02AL 50-113, 127-204, 242-267, 282-296, 348-387| PSIPRED cEEEEEEccccHHHHHHHHcccHHHHHHHccccccccEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //